DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and CG17030

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:88 Identity:27/88 - (30%)
Similarity:48/88 - (54%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PAGTPYAAGIFRVKLTLNKDFPLTPPKAYFLTKIFHPNVAANGEICVNTLK-KDWKPDLGIKHIL 116
            |...||..|.:::::....|:|..||:.:..|:::|.||...|::||..|: :.|.|...|..:|
  Fly    50 PVAPPYDKGAYKMEIDFPLDYPFKPPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVL 114

  Fly   117 LTIKCLLIVPNPESALN-EEAGK 138
            ..:...:..|.||:|.: |.||:
  Fly   115 QVLLATINDPQPENAWHIEMAGE 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 27/88 (31%)
UBCc 16..155 CDD:238117 27/88 (31%)
CG17030NP_647941.1 COG5078 12..158 CDD:227410 27/88 (31%)
UQ_con 14..153 CDD:278603 27/88 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.