DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and CG16894

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 / 37280 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster


Alignment Length:180 Identity:42/180 - (23%)
Similarity:71/180 - (39%) Gaps:44/180 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSNVENLSPQTIRQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTP-----------Y 58
            ||.|.|.|...|:|....|.|..         |:.| ::.:|.|:.....|..           |
  Fly     3 YSTVRNPSIALIKQGYHILAEYN---------LVKE-ELKNIYAIPSYACGLHWFGVIFVHSGIY 57

  Fly    59 AAGIFRVKLTLNKDFP--LTPPKAYFLTKIFHPNVA-ANGEICVNTLKKDWKPD-LGIKHILLTI 119
            |..:||..:.|.::||  ::.|...|.|::.||::. .|..:.:.....:|:.| ..|.|:|..|
  Fly    58 AGSVFRFSILLPENFPADISLPTVVFSTEVLHPHICPQNKTLDLAHFLNEWRKDEHHIWHVLRYI 122

  Fly   120 KCLLIVPNPESAL-----------------NEEAGKMLLERYDDYSQRAR 152
            :.  |..:||.::                 |..|..||.:...:|.:|.:
  Fly   123 QA--IFADPEGSICTGQSSSGDLVIMDEVRNMNALNMLAKSRPEYIKRVQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 38/173 (22%)
UBCc 16..155 CDD:238117 37/169 (22%)
CG16894NP_611455.1 COG5078 20..176 CDD:227410 35/163 (21%)
UBCc 23..173 CDD:294101 34/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.