DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and Ubc10

DIOPT Version :10

Sequence 1:NP_573237.2 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster


Alignment Length:158 Identity:40/158 - (25%)
Similarity:74/158 - (46%) Gaps:21/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RQVMRELQEMETTPPEGIKVLINESDVTDIQALIDG---------PAGTPYAAGIFRVKLTLNKD 72
            |::.:||.:::....:..:         ||:|..|.         |...||..|.||:::....:
  Fly     5 RRLRKELSDLQGNALKSFR---------DIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAE 60

  Fly    73 FPLTPPKAYFLTKIFHPNVAANGEICVNTLK-KDWKPDLGIKHILLTIKCLLIVPNPESALNEEA 136
            :|..|||..|.|:|:|||:...|::|:..:. ::|||......::..:..|:..|.||..|..|.
  Fly    61 YPFKPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAEL 125

  Fly   137 GKMLLERYDDYSQRARMMTEIHAQ--PA 162
            .:..|:....:.:.|...|:.|::  ||
  Fly   126 AEEFLKDRKKFVKNAEDYTKKHSEKRPA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_573237.2 UBCc_UBE2S 13..158 CDD:467424 37/150 (25%)
Ubc10NP_477414.1 UBCc_UBE2L3 3..149 CDD:467421 38/152 (25%)

Return to query results.
Submit another query.