DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and ubc-9

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001023158.1 Gene:ubc-9 / 3565767 WormBaseID:WBGene00006706 Length:166 Species:Caenorhabditis elegans


Alignment Length:108 Identity:39/108 - (36%)
Similarity:61/108 - (56%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QALIDGPAGTPYAAGIFRVKLTLNKDFPLTPPKAYFLTKIFHPNVAANGEICVNTL--KKDWKPD 109
            :..|.|...|.:..|::|:::....|||.||||..|...:|||||..:|.:|::.|  .|||||.
 Worm    42 ECAIPGRKDTIWEGGLYRIRMLFKDDFPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDENKDWKPS 106

  Fly   110 LGIKHILLTIKCLLIVPNPESALNEEAGKMLLERYDDYSQRAR 152
            :.||.:|:.|:.||..||.|.....||.::..:...:|.:|.:
 Worm   107 ISIKQLLIGIQDLLNHPNIEDPAQAEAYQIYCQNRAEYEKRVK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 39/108 (36%)
UBCc 16..155 CDD:238117 39/108 (36%)
ubc-9NP_001023158.1 COG5078 1..156 CDD:227410 39/108 (36%)
UQ_con 8..149 CDD:278603 39/106 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53499
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.