DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and CG4502

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:181 Identity:41/181 - (22%)
Similarity:70/181 - (38%) Gaps:36/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RQVMRELQEMETTPPEGIKV----LINES--------DVTDIQALIDGPAGTPYA-AGIFRVKLT 68
            |::|:|.:|||....:...|    |:|:|        .|.|    .|.|.....| .|:..:.|.
  Fly   141 RRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVID----PDSPLARDMAEMGVPAILLH 201

  Fly    69 LN--KDFPLTPPKAYFLTKIFHPN-----VAANGEICVNTL-KKDWKPDLGIKHILLTIKCLLIV 125
            |:  .:||..||    ..::..|:     |...|.||:..| .:.|.....::.:::.....::.
  Fly   202 LSFPDNFPFAPP----FMRVVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAASVVK 262

  Fly   126 PNPESALNEEAGKMLLERYDDYSQRARMMTEIHAQPAKCGVGAVGDAKDDG 176
            .....|...::.|....|..:.|.|:.:.|  |.:     .|.|..|..||
  Fly   263 GQGRIARKPKSTKEFTRRQAEESFRSLVKT--HEK-----YGWVTPALSDG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 35/162 (22%)
UBCc 16..155 CDD:238117 34/158 (22%)
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 29/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.