DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and morgue

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster


Alignment Length:144 Identity:44/144 - (30%)
Similarity:72/144 - (50%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VMR------ELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDFPLTP 77
            |||      |...:.:...|||..:..:......||.|.||.|:||..|.|.:.:...:.:|:||
  Fly   336 VMRNNFLRGEANLLNSYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTP 400

  Fly    78 PKAYFLTKIFHPNVAANGEICVNTLKK-DWKPDLGIKHILLTIKCLLIVPNPESALNEEAGKMLL 141
            |...|||||.||||:.:|::.::..:: :|...|.:..:||:::.||..|..|..:..|.|.:..
  Fly   401 PTVRFLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDPYTEVCMEPELGYIYE 465

  Fly   142 ERYDDYSQRARMMT 155
            ...:.:.|..|..|
  Fly   466 HERERFEQLVRAWT 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 44/144 (31%)
UBCc 16..155 CDD:238117 43/142 (30%)
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 40/136 (29%)
COG5078 355..485 CDD:227410 40/125 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.