DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and UbcE2H

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster


Alignment Length:136 Identity:38/136 - (27%)
Similarity:72/136 - (52%) Gaps:13/136 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IKVLINESDVTDIQALID------GPAGTPYAAGIFRVKLTLNKDFPLTPPKAYFLTKIFHPNV- 91
            ||::.::.:||.:..|.:      ||..|||..|:::|::.|..::|...|...|:.||:|||: 
  Fly    16 IKLIESKHEVTILGGLNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNID 80

  Fly    92 AANGEICVNTLKKDWKPDLGIKHILLT-IKCLLIVPNPESALNEEAGKMLLERYDDYSQRA---- 151
            .::|.:|::.:.:.|.....:.:|..: :..||..|||...||.:|..:.|...::|.::.    
  Fly    81 ESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYV 145

  Fly   152 -RMMTE 156
             |..||
  Fly   146 QRYATE 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 38/136 (28%)
UBCc 16..155 CDD:238117 36/133 (27%)
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.