DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8188 and UBE2S

DIOPT Version :9

Sequence 1:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_055316.2 Gene:UBE2S / 27338 HGNCID:17895 Length:222 Species:Homo sapiens


Alignment Length:224 Identity:127/224 - (56%)
Similarity:152/224 - (67%) Gaps:24/224 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SNVENLSPQTIRQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLN 70
            ||||||.|..||.|.:|:..:...||:||||..||.|:||:|..|:||.|||||.|:||:||.|.
Human     3 SNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLG 67

  Fly    71 KDFPLTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEE 135
            ||||.:|||.|||||||||||.||||||||.||:||..:|||:|:|||||||||.||||||||||
Human    68 KDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEE 132

  Fly   136 AGKMLLERYDDYSQRARMMTEIH-------------------AQPAKCGVGAVGDAKDDGGPSTK 181
            ||::|||.|::|:.|||::||||                   .:.:....||.|......||..|
Human   133 AGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAK 197

  Fly   182 KHAG-LDKKLQDKKKEKLLKEKKRMLKRL 209
            |||| .||||..|||    .:|||.|:||
Human   198 KHAGERDKKLAAKKK----TDKKRALRRL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 98/165 (59%)
UBCc 16..155 CDD:238117 93/138 (67%)
UBE2SNP_055316.2 UQ_con 16..152 CDD:306648 91/135 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 156..222 21/69 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159996
Domainoid 1 1.000 201 1.000 Domainoid score I3027
eggNOG 1 0.900 - - E2759_KOG0423
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56676
Inparanoid 1 1.050 245 1.000 Inparanoid score I3299
Isobase 1 0.950 - 0 Normalized mean entropy S899
OMA 1 1.010 - - QHG53499
OrthoDB 1 1.010 - - D1412570at2759
OrthoFinder 1 1.000 - - FOG0007037
OrthoInspector 1 1.000 - - oto89383
orthoMCL 1 0.900 - - OOG6_103684
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4812
SonicParanoid 1 1.000 - - X5130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.