DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRMT2 and Art1

DIOPT Version :9

Sequence 1:NP_001526.2 Gene:PRMT2 / 3275 HGNCID:5186 Length:433 Species:Homo sapiens
Sequence 2:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster


Alignment Length:338 Identity:113/338 - (33%)
Similarity:183/338 - (54%) Gaps:38/338 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    81 ANHVGK--------------HVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQ 131
            :|:|.|              :.||....|     .||.||....:|.|||.|:.||..|.:.:..
  Fly    26 SNNVAKKLPAEGSTGDNPNANADEMTSRD-----YYFDSYAHFGIHEEMLKDEVRTVTYRNAMYH 85

Human   132 NKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKV 196
            ||.....|.:|||||||||:|:|.|. |....|.||:.|.:.:...|:|:.|...|:|||.:.|:
  Fly    86 NKHLFQGKTVLDVGCGTGILSMFAAK-AGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKI 149

Human   197 EDVVLP---EKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDY 258
            |::.||   |.||:::|||||.||.:|.|::::|||||.|||:||:::|....|::.... |:.|
  Fly   150 EEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIE-DRQY 213

Human   259 R-SKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETL 322
            : .|:.:||:.|.|::|.::.:||.|    |..: ::.|:..:|..|.:.::|:.|||.:|| ..
  Fly   214 KDEKINWWDDVYGFDMSCIRKVAVTE----PLVD-VVDPKQVVSTSCMVKEVDLYTVQKADL-NF 272

Human   323 RGELRFDIRKAGTLHGFTAWFSVHFQSLQE--GQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHT 385
            ..:....|::...:.....:|::.|....:  |     .||.|....||||||:|.:||.:....
  Fly   273 SSKFSLCIKRNDFVQALVTYFNIEFTKCHKRLG-----FSTSPDSTYTHWKQTVFYLDDHMTAKK 332

Human   386 GDVVTGSVVLQRN 398
            .:.:||:..::.|
  Fly   333 NEEITGTFQMKPN 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRMT2NP_001526.2 Interaction with ESR1 1..277 81/213 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SH3_PRMT2 34..86 CDD:212740 2/4 (50%)
Interaction with RB1. /evidence=ECO:0000250 83..207 50/140 (36%)
AdoMet_MTases 110..>169 CDD:302624 27/58 (47%)
Interaction with ESR1 133..275 61/145 (42%)
AdoMet_MTases 141..241 CDD:100107 50/102 (49%)
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 48/100 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.