DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12990 and CG30467

DIOPT Version :9

Sequence 1:NP_573233.1 Gene:CG12990 / 32747 FlyBaseID:FBgn0030859 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_611044.1 Gene:CG30467 / 36719 FlyBaseID:FBgn0050467 Length:521 Species:Drosophila melanogaster


Alignment Length:176 Identity:34/176 - (19%)
Similarity:65/176 - (36%) Gaps:66/176 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 VPEVEQLIRKS----MAKEESFHCWDMDAKLAYAKKPELKTNFFDSGA--------------VQI 200
            |..|.:|:|.|    ..:::....|||..      .||:.|...::||              |::
  Fly    85 VMRVGELLRHSTLDQQLEDDLCKVWDMSV------SPEVVTLLLENGAIDPIMYTLVAGCEDVRL 143

  Fly   201 FFVVLGVTLLLTLAATSGLGKYSRILACFDFA-----------DNWRLAWKPVNPSQENRPVNGL 254
            :.:::|  ||..:.|..   :.:.||||..:.           |...|                :
  Fly   144 YEILIG--LLGNMCAQV---ECAEILACDRYTLETLFKMTYCMDTAML----------------I 187

  Fly   255 RVLTAFSLIGVHVI---------WYKYFSV-DPSVEMLGKLSSMTM 290
            :::..|..|..||:         ||..|:. :.|.:.||::..:::
  Fly   188 QLMRLFQYIMAHVLSGKEKFAVNWYICFAAFENSAQNLGRILQLSV 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12990NP_573233.1 NRF 61..162 CDD:214781 3/7 (43%)
Acyl_transf_3 251..637 CDD:280013 10/50 (20%)
OafA 295..660 CDD:224748
CG30467NP_611044.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.