DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12990 and oac-30

DIOPT Version :9

Sequence 1:NP_573233.1 Gene:CG12990 / 32747 FlyBaseID:FBgn0030859 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_493935.3 Gene:oac-30 / 185942 WormBaseID:WBGene00018573 Length:647 Species:Caenorhabditis elegans


Alignment Length:431 Identity:76/431 - (17%)
Similarity:154/431 - (35%) Gaps:152/431 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 LIGVHVIWYKYFSVDPSVEMLGKLSSMTMRHTYWPTMVEIFFVVSGYLTVLNFIRDEQLQKDIAS 326
            |.|:.:|....|.:.|::...|.|.            |:||||:||||...|..:.:        
 Worm     8 LRGIAIISVFLFHLLPNLFFNGFLG------------VDIFFVISGYLMARNLTKSK-------- 52

  Fly   327 DGILGNMRRYLREFIHRYCRLAPLQFVIVLMGVVVI---------EYQRQVSV---------MQI 373
               |.::|.:|..:..|:.|:.||.::::.:.::::         |...:.|:         :.|
 Worm    53 ---LTSIRDFLEFYYRRFRRILPLYYLLIFLIIIMVHLWLPYILWENSNRYSIASLFLMTNQLVI 114

  Fly   374 TDPQD-------ELCRLNAVRNVFFIQNLFPIQFMCGSWTWSLGCDMQLHMTAMLLLF-MHTKHP 430
            .|..|       |...:||..::                 |||..:||.::....:.| :.....
 Worm   115 HDQADYFNSFRAESTAINAFLHL-----------------WSLSLEMQFYLLVPCIFFALQILKS 162

  Fly   431 NMVKWIVRL-----------LVVISALFSIVFMEVNEVGANFEEMYHTNEWSYMSPLIRMLAYII 484
            :.:|.:..:           ||:.|..|:.:|:.:.:..|.|..::    ||             
 Worm   163 DYLKLLAAILTTTIGFVCFALVLDSFAFNFMFLRLWQFSAGFVALF----WS------------- 210

  Fly   485 GGSYAFFQVKGTGTPFDLVMPNWWIRLGAIACIGWLARQVTMDQLPAISIILSF--------MVV 541
                          ..:..:|.........|...|::..   ||:....::|..        ::|
 Worm   211 --------------KIEQKLPEKNSEKSETAKPTWISED---DQVTVALVVLGVCIMPYDVNVLV 258

  Fly   542 LRILVSTAASHLIICGTKPDNSDSYAPTRWLLALLQSEQVQRISKFTYAIYLLN-PIVIMYVYHS 605
            :|.||:...:.:|...::.:.            :|.|:.:..|...:|..||:: |::.::    
 Worm   259 IRPLVTVVTAFIIKLQSESNQ------------ILNSKTLSYIGDISYVTYLVHWPVISIF---- 307

  Fly   606 FSNEVYPDNTMMIMLAISCSVVCYLWAIVMTVLFEIPFNRL 646
                            ::.||..|::.||.|||..|..:.|
 Worm   308 ----------------LTSSVNSYVFCIVTTVLASIALHHL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12990NP_573233.1 NRF 61..162 CDD:214781
Acyl_transf_3 251..637 CDD:280013 71/420 (17%)
OafA 295..660 CDD:224748 69/398 (17%)
oac-30NP_493935.3 OafA 1..340 CDD:224748 76/431 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.