DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and DDX18

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_006764.3 Gene:DDX18 / 8886 HGNCID:2741 Length:670 Species:Homo sapiens


Alignment Length:653 Identity:214/653 - (32%)
Similarity:322/653 - (49%) Gaps:106/653 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RQKPKGPG----KPGSRFKPGSGTFKGAGGGRKS-----------GDNSQKRPRQEINKSRLAAT 52
            :|||...|    :.|...:...|..|.....:||           ..||:.:.:::..:..:...
Human    57 KQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDA 121

  Fly    53 EAEIQDLKT----KYAEIDATAIK----------------KFAQFPL------------------ 79
            |.:.:..||    |..|..|...|                :....||                  
Human   122 EPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPSLPLGLTGAFEDTSFASLCNLV 186

  Fly    80 SKKTQKALAESKFVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHLFMNKWSRTDG 144
            ::.|.||:.|..|.:.|::|..||.|.|:|:|:|.||.||||||||||||.:|.:...::...:|
Human   187 NENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNG 251

  Fly   145 VGAIIISPTRELAYQIFETLKKVGKHHDFSAGLIIGGKNLKFERTRM-DQCNILICTPGRLLQHM 208
            .|.:|:|||||||.|.|..||::..||..:.|||:||.|...|..:: :..||::.||||||.||
Human   252 TGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLDHM 316

  Fly   209 DENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFPPVRQTLLFSATQTNTVQDLARLNL-K 272
            ...|.|....::.||:|||||.||:||::.|..||:..|..|||:|||||||..|:||||::| |
Human   317 QNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKK 381

  Fly   273 DPVYVGYGGATPREEPSASTKKTPNTAVLAVPELLQQSYVVLNLEDKITMLWSFIKNHLKQKIIV 337
            :|:|||.      ::..|:          |..:.|:|.|||...|.:..:|::|:|.:.|:|::|
Human   382 EPLYVGV------DDDKAN----------ATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKLMV 430

  Fly   338 FVASCKQAKYLYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPA 402
            |.:||...||.||:...:  ..|:||::|...|::|...:..|.......:..||||:||||.|.
Human   431 FFSSCMSVKYHYELLNYI--DLPVLAIHGKQKQNKRTTTFFQFCNADSGTLLCTDVAARGLDIPE 493

  Fly   403 VNWVVQLDCPEDVSQYIHRAGRSARN-KTRGECLLVLTPSEEEYMISALKEQLNIDIRCVQIDPK 466
            |:|:||.|.|:|..:||||.||:||. ..||..||:|.| ||...:..|| |..:.:........
Human   494 VDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALLILRP-EELGFLRYLK-QSKVPLSEFDFSWS 556

  Fly   467 KLFSPRVKIEAFLAQFPELRATAQRAFLSYIKSVFLMRNKRLFNVFSLDLDAFAQSLGLAVTPRV 531
            |:...:.::|..:.:...|..:||.|:.|||::......|::|||.:|:|...|.|.|..|.|.|
Human   557 KISDIQSQLEKLIEKNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPFV 621

  Fly   532 PFLEKFLWRQKQLQQQKEQGDNAKSINPLLSKLTKQQSFGGG-----DEDEENSDDEDFIKVKRK 591
                       .|.....:|              ||:..|||     .:.::....:.|..:.:|
Human   622 -----------DLNVNSNEG--------------KQKKRGGGGGFGYQKTKKVEKSKIFKHISKK 661

  Fly   592 DHD 594
            ..|
Human   662 SSD 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 184/523 (35%)
DEADc 74..277 CDD:238167 99/222 (45%)
HELICc 311..437 CDD:238034 51/126 (40%)
DUF4217 474..530 CDD:290667 18/55 (33%)
DDX18NP_006764.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..169 19/111 (17%)
DEADc 179..386 CDD:238167 97/206 (47%)
Q motif 179..207 6/27 (22%)
DEXDc 194..382 CDD:214692 92/187 (49%)
DEAD box 333..336 2/2 (100%)
HELICc 400..529 CDD:238034 53/130 (41%)
DUF4217 561..619 CDD:290667 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D218522at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.