DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and AT1G71280

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_177284.1 Gene:AT1G71280 / 843469 AraportID:AT1G71280 Length:465 Species:Arabidopsis thaliana


Alignment Length:638 Identity:156/638 - (24%)
Similarity:249/638 - (39%) Gaps:191/638 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IQDLKTKYAEIDATAIKKFAQFPLSKKTQKALAESKFVHPTQVQRDSIGPALQGKDVLGAAITGS 120
            |::...:::|:..         |||:...:||..|.|...|.||.::|......|||:..|.|||
plant    10 IEEAPPRFSELKP---------PLSEDIIEALDRSGFEVCTPVQAETIPFLCSHKDVVVDAATGS 65

  Fly   121 GKTLAFLIPVLEHL-FMNKW-SRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFSAGLIIGGKN 183
            |||||||:|.:|.: ..|.: .:...|..:||||||||:.||.:..:.|  ..||:.     .:.
plant    66 GKTLAFLLPFIEIIRRSNSYPPKPHQVMGVIISPTRELSAQIHKVARAV--RLDFAK-----CRE 123

  Fly   184 LKFERTRMDQ--CNILICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIENF 246
            ::.:...:::  .|:||.|||||...|......:...:|:|:||||||.|||||||.:|.||...
plant   124 VEADMNTLEEEGANLLIGTPGRLSDMMKRMEFLDFRNLEILILDEADRLLDMGFQKQVNYIISRL 188

  Fly   247 PPVRQTLLFSATQTNTVQDLARLNLKDPVYVGYGGATPREEPSASTKKTPNTAVLAVPELLQQSY 311
            |..|:|.|||||||..|.|||:..|::|                                    |
plant   189 PKQRRTGLFSATQTQAVADLAKAGLRNP------------------------------------Y 217

  Fly   312 VVLNLEDKITMLWSFIKNHLKQKIIVFVASCKQAKYLYEIFCKLRPGSPLLALY---GTLHQDRR 373
            :....:.|.:.|...:..:..:|::||..:|....|...:..|: |....::.:   |.:.|..|
plant   218 LKCEADQKSSQLVHLLIENKNKKLVVFFMTCACVDYWGLVISKI-PSLKSISFFPTHGKMDQKGR 281

  Fly   374 IAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDVSQYIHRAGRSARNKTRGECLLVL 438
            ......|...|..|:..||||:||||.|.:.::..|                             
plant   282 DTALASFTEASSGVLLCTDVAARGLDIPGIVYIRSL----------------------------- 317

  Fly   439 TPSEEEYMISALKEQLNIDIRCVQIDPKKLFSPRVKIEAFLAQFPELRATAQRAFLSYIKSVFLM 503
                      |:|::                              |:.....:||:|::::....
plant   318 ----------AIKDR------------------------------EVLEKGLKAFVSFVRAYKEH 342

  Fly   504 RNKRLFNVFSLDLDAFAQSLGLAVTPRVPFLEKFLWRQKQLQQQKEQGDNAKSINPLLSKLTKQQ 568
            :...:|:...|::...|...|:     :.|                         |.:|:: ||.
plant   343 QCSYIFSWKGLEIGKLAMGYGI-----LSF-------------------------PYISEV-KQD 376

  Fly   569 SFG-GGDEDEENSDDEDFIKVKRKDHDVEGEPVKLDEEDDTENEAEAPLVVPKREKLVTKASLAK 632
            ..| .|....:....|| ||.|.|..:.:.:...|..:|..:.|...     ||:|         
plant   377 RIGIVGFTPVQGITFED-IKFKNKSREKQRQQNLLARKDKLQQEKRG-----KRKK--------- 426

  Fly   633 KALKKNLQVNSKLKFDDEGETMADDRSQMKALSARQR-TVNQDDDDGGINLVL 684
                     :||...||..:.     |:.:.|:.||| |:....|:..:||.|
plant   427 ---------SSKEAVDDSNKA-----SRKRKLTGRQRQTIQTAQDEEEMNLRL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 115/421 (27%)
DEADc 74..277 CDD:238167 85/206 (41%)
HELICc 311..437 CDD:238034 26/128 (20%)
DUF4217 474..530 CDD:290667 8/55 (15%)
AT1G71280NP_177284.1 DEADc 17..217 CDD:238167 86/251 (34%)
DEXDc 32..217 CDD:214692 81/227 (36%)
Helicase_C 223..>314 CDD:278689 24/91 (26%)
DUF4217 314..368 CDD:290667 12/152 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.