DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and EMB1586

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001322468.1 Gene:EMB1586 / 837833 AraportID:AT1G12770 Length:551 Species:Arabidopsis thaliana


Alignment Length:509 Identity:133/509 - (26%)
Similarity:225/509 - (44%) Gaps:78/509 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KPKGPGKPGSRFKPGSGTFKGAGGGRKSGDNSQKRPRQEINKSRLAATEAEIQDLKTKYAEIDAT 69
            ||:..|| |...|.........|.|:.   .:.|..:.::.|.:             |.|||.:.
plant    58 KPRKFGK-GKAMKLEGSFVTEMGQGKV---RAVKNDKMKVVKEK-------------KPAEIVSP 105

  Fly    70 --AIKKFAQFPLSKKTQKALAESKFVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLE 132
              :.|.|.:..|......:|....|..||.||..::...::|.|.:..:.||||||||:|:|:|.
plant   106 LFSAKSFEELGLPDSLLDSLEREGFSVPTDVQSAAVPAIIKGHDAVIQSYTGSGKTLAYLLPILS 170

  Fly   133 HL----------FMNKWSRTDGVGAIIISPTRELAYQIFETLKK-VGKHHDFSAGLIIGGKNLKF 186
            .:          ......||: :.|:|::|:|||..||...::| :|..|......::||.|   
plant   171 EIGPLAEKSRSSHSENDKRTE-IQAMIVAPSRELGMQIVREVEKLLGPVHRRMVQQLVGGAN--- 231

  Fly   187 ERTRMDQC------NILICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIEN 245
             |.|.::.      .|::.||||:.: :.:....:|.....|||||.|..|...|::.::.|:|:
plant   232 -RMRQEEALKKNKPAIVVGTPGRIAE-ISKGGKLHTHGCRFLVLDEVDELLSFNFREDIHRILEH 294

  Fly   246 F--------------PPVRQTLLFSATQTNTVQDLARLNLKDPVYVGYGGATPRE--EPSASTKK 294
            .              ...|||:|.|||...:|...|:....:||.|.....||.:  :|||....
plant   295 VGKRSGAGPKGEVDERANRQTILVSATVPFSVIRAAKSWSHEPVLVQANKVTPLDTVQPSAPVMS 359

  Fly   295 -TPNTA---------VLAVPELLQQSYVVLNLEDKITMLWSFIKNHLKQKIIVFVASCKQAKYLY 349
             ||.|:         :.::|..|:..|.:...:.|:..|...:.....|.:|.|:...:|.|   
plant   360 LTPTTSEADGQIQTTIQSLPPALKHYYCISKHQHKVDTLRRCVHALDAQSVIAFMNHSRQLK--- 421

  Fly   350 EIFCKLRP-GSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLDCPE 413
            ::..||.. |.....::|.|.:..|..:.:.|......|:.:.::::||||....:.||.|:.|.
plant   422 DVVYKLEARGMNSAEMHGDLGKLGRSTVLKKFKNGEIKVLVTNELSARGLDVAECDLVVNLELPT 486

  Fly   414 DVSQYIHRAGRSARNKTRGECLLVLTPSEEE--YMISALKEQLNID-IRCVQID 464
            |...|.|||||:.|...:|   .|:|..||.  :::..:::||.:. :.|..:|
plant   487 DAVHYAHRAGRTGRLGRKG---TVVTVCEESQVFIVKKMEKQLGLPFLYCEFVD 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 133/509 (26%)
DEADc 74..277 CDD:238167 66/233 (28%)
HELICc 311..437 CDD:238034 33/126 (26%)
DUF4217 474..530 CDD:290667
EMB1586NP_001322468.1 P-loop_NTPase 112..340 CDD:304359 66/233 (28%)
DEXDc 125..349 CDD:214692 67/229 (29%)
HELICc 384..510 CDD:238034 34/131 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.