DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and AT3G18600

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_188490.1 Gene:AT3G18600 / 821391 AraportID:AT3G18600 Length:568 Species:Arabidopsis thaliana


Alignment Length:569 Identity:197/569 - (34%)
Similarity:320/569 - (56%) Gaps:42/569 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QRQKPKGPGKPGSRFKPGSGTFKGAGGGRKSGDNSQKRPRQEINKSR--LAATEAEIQDLKTKYA 64
            :|.:.:..||...:.|....|..    ..::.|.:||:..:::.|.|  :...|.:::.::....
plant    14 KRVRKRSRGKKNEQQKAEEKTHT----VEENADETQKKSEKKVKKVRGKIEEEEEKVEAMEDGED 74

  Fly    65 EIDATAIKK-------FAQFPLSKKTQKALAESKFVHPTQVQRDSIGPALQGKDVLGAAITGSGK 122
            |.:...:.|       |....||::|..|:.|..|.:.||:|..||.|.|:||||||||.|||||
plant    75 EKNIVIVGKGIMTNVTFDSLDLSEQTSIAIKEMGFQYMTQIQAGSIQPLLEGKDVLGAARTGSGK 139

  Fly   123 TLAFLIPVLEHLFMNKWSRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFSAGLIIGGKNLKFE 187
            |||||||.:|.||..::|..:|.|.|:|.||||||.|.....:::.|||..:..::|||.|.:.|
plant   140 TLAFLIPAVELLFKERFSPRNGTGVIVICPTRELAIQTKNVAEELLKHHSQTVSMVIGGNNRRSE 204

  Fly   188 RTRM-DQCNILICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFPPVRQ 251
            ..|: ...|::|.||||||.|:.....|....::.||:|||||.|:..|::.:|.|::..|..||
plant   205 AQRIASGSNLVIATPGRLLDHLQNTKAFIYKHLKCLVIDEADRILEENFEEDMNKILKILPKTRQ 269

  Fly   252 TLLFSATQTNTVQDLARLNLKDPVYVGYGGATPREEPSASTKKTPNTAVLAVPELLQQSYVVLNL 316
            |.|||||||:.|:||||::|..||:|         :.....:|..|       |.|:|.|.|:..
plant   270 TALFSATQTSKVKDLARVSLTSPVHV---------DVDDGRRKVTN-------EGLEQGYCVVPS 318

  Fly   317 EDKITMLWSFIKNHLKQKIIVFVASCKQAKYLYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFL 381
            :.::.:|.||:|.:|.:||:||.::||..::..||. |: ....:..::|.:.|:||...:.||:
plant   319 KQRLILLISFLKKNLNKKIMVFFSTCKSVQFHTEIM-KI-SDVDVSDIHGGMDQNRRTKTFFDFM 381

  Fly   382 RKSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDVSQYIHRAGRSARNK-TRGECLLVLTPSEEEY 445
            :....::..||||:||||.|:|:|::|.|.|:..::||||.||:||.: .:|:.||||.|.|.::
plant   382 KAKKGILLCTDVAARGLDIPSVDWIIQYDPPDKPTEYIHRVGRTARGEGAKGKALLVLIPEELQF 446

  Fly   446 M--ISALKEQLNIDIRCVQIDPKKLFSPRVKIEAFLAQFPELRATAQRAFLSYIKSVFLMRNKRL 508
            :  :.|.|    :.::.::.:.|:|.:.:..:|..:|:...|...|:.|:.:|:.:......|.:
plant   447 IRYLKAAK----VPVKELEFNEKRLSNVQSALEKCVAKDYNLNKLAKDAYRAYLSAYNSHSLKDI 507

  Fly   509 FNVFSLDLDAFAQSLGLAVTPRVPF-LEKFLWRQKQLQQQKEQGDNAKS 556
            |||..|||.|.|:|...:..|:|.. :|.  ...|..:.:|:||.|..|
plant   508 FNVHRLDLLAVAESFCFSSPPKVNLNIES--GAGKVRKARKQQGRNGFS 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 172/481 (36%)
DEADc 74..277 CDD:238167 98/203 (48%)
HELICc 311..437 CDD:238034 46/126 (37%)
DUF4217 474..530 CDD:290667 16/55 (29%)
AT3G18600NP_188490.1 SrmB 86..553 CDD:223587 183/490 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.