DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and DDX56

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_061955.1 Gene:DDX56 / 54606 HGNCID:18193 Length:547 Species:Homo sapiens


Alignment Length:556 Identity:149/556 - (26%)
Similarity:254/556 - (45%) Gaps:83/556 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 FAQFPLSKKTQKALAESKFVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHLFMNK 138
            |....|..:..:|:.:..:..||.:|..:|..||:|||:|..|.||||||.|:.||:|:.|...|
Human     9 FEHMGLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGKTAAYAIPMLQLLLHRK 73

  Fly   139 WSR---TDGVGAIIISPTRELAYQIFETLKKVGKH--HDFSAGLIIGGKNLKFER-TRMDQCNIL 197
            .:.   ...|..:::.||:|||.|....::::..:  .|.....:...::...:| ..|::.:::
Human    74 ATGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVV 138

  Fly   198 ICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFPPVRQTLLFSATQTNT 262
            :.||.|:|.|:.::.|....::|:||:||||.....||::.|.|::.:.|.:.|..|.|||....
Human   139 VGTPSRILSHLQQDSLKLRDSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNED 203

  Fly   263 VQDLARLNLKDPVYVGYGGATPREEPSASTKKTPNTAVLAVPELLQQSYVVLNL-EDKITMLWSF 326
            ||.|..|.|.:||                |.|...:. |..|:.|||..||... |||..:|::.
Human   204 VQALKELILHNPV----------------TLKLQESQ-LPGPDQLQQFQVVCETEEDKFLLLYAL 251

  Fly   327 IK-NHLKQKIIVFVASCKQAKYLYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFS 390
            :| :.::.|.::||.:.::: |...:|.: :...|...|.|.|....|..|...|.:..:..:.:
Human   252 LKLSLIRGKSLLFVNTLERS-YRLRLFLE-QFSIPTCVLNGELPLRSRCHIISQFNQGFYDCVIA 314

  Fly   391 TDV---------------------------ASRGLDFPAVNWVVQLDCPEDVSQYIHRAGRSARN 428
            ||.                           .:||:||..|:.|:..|.|.....|||||||:||.
Human   315 TDAEVLGAPVKGKRRGRGPKGDKASDPEAGVARGIDFHHVSAVLNFDLPPTPEAYIHRAGRTARA 379

  Fly   429 KTRGECLLVLTPSEEEYMISALKEQLNIDIRCVQIDPKKLFSPRV-KIEAFLAQFPE-LRATAQR 491
            ...|..|..:.|: |::.:..::|.|:.:.|...:.|   :..|: :||.|..:..: :|:..::
Human   380 NNPGIVLTFVLPT-EQFHLGKIEELLSGENRGPILLP---YQFRMEEIEGFRYRCRDAMRSVTKQ 440

  Fly   492 AF----LSYIKSVFLMRNKRLFNVFS---LDLDAFAQSLGL---AVTPRVPFLEKFL-------- 538
            |.    |..||.. |:.:::|...|.   .||......|.|   .|.|.:..:..:|        
Human   441 AIREARLKEIKEE-LLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPPALRGL 504

  Fly   539 ----WRQKQLQQQKEQGDNAKSINPLLSKLTKQQSF 570
                .::|:|.....:...|||.|||.|...|.:.|
Human   505 VRPHKKRKKLSSSCRKAKRAKSQNPLRSFKHKGKKF 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 119/431 (28%)
DEADc 74..277 CDD:238167 66/208 (32%)
HELICc 311..437 CDD:238034 40/154 (26%)
DUF4217 474..530 CDD:290667 16/66 (24%)
DDX56NP_061955.1 Q motif 7..35 5/25 (20%)
SrmB 9..513 CDD:223587 138/527 (26%)
DEADc_DDX56 14..220 CDD:350719 66/221 (30%)
DEAD box 166..169 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 506..547 11/35 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.