DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and ddx51

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001003864.1 Gene:ddx51 / 445387 ZFINID:ZDB-GENE-040927-28 Length:652 Species:Danio rerio


Alignment Length:469 Identity:122/469 - (26%)
Similarity:195/469 - (41%) Gaps:77/469 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TKYAEIDATAIKKFAQFPLSKKTQKALAESKFVHPTQVQRDSIGPAL-------QGKDVLGAAIT 118
            |...::....|:.|  ||:..:...|:.|            |:|..|       :.:||..:|.|
Zfish   199 TLLRKLQTNGIQSF--FPVQAEVIPAILE------------SVGSGLLVGPGGYRPRDVCVSAPT 249

  Fly   119 GSGKTLAFLIPVLEHLFMNKWSRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFSAGLIIGGKN 183
            ||||||||:|||::.|......:   |.|:.:.||:|||.|:........:.......:|.|.|:
Zfish   250 GSGKTLAFVIPVVQALSKRVVRQ---VRALAVLPTKELAQQVSNVFSAYTEGSSLKVVMITGQKS 311

  Fly   184 LKFERTRMDQ---------CNILICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMGFQKTL 239
            ...|:|.:.:         .:|::.|||||:.|:::|..|:...:..|::|||||.:|...|..|
Zfish   312 FAAEQTALSEIRGGVSHSMADIVVATPGRLVDHINKNSSFSLQHLRFLIIDEADRMIDSMHQSWL 376

  Fly   240 NSIIENF--------------------------PP--VRQTLLFSATQTNTVQDLARLNLKDPVY 276
            :.:.:..                          ||  ..|.||||||.|...:.|..|:|..|..
Zfish   377 SQVTKAVYSTPGETHTSVFRRTVPGPITAASLSPPQIPLQKLLFSATLTQNPEKLQLLDLHQPRL 441

  Fly   277 VGYGGATPREEPSASTKKTPNTA----VLAVPELLQQSYVVLNLEDKITMLWSFIKNHLKQKIIV 337
            .           |::...|.|.|    ....|:.|.:.||......|..::..|:........:.
Zfish   442 F-----------SSTHSLTDNPAQSQDTFHFPQGLSEYYVPCTFSKKPLIILHFLLRLKFSPALC 495

  Fly   338 FVASCKQAKYLYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPA 402
            |..|.:.|..|| :..||..|..:......|....|....:||.:....::.|||.|:||:|...
Zfish   496 FTNSREGAHRLY-LLVKLFGGVEVAEFSSKLSPGERQKTLKDFEKGKIPLLISTDAAARGIDING 559

  Fly   403 VNWVVQLDCPEDVSQYIHRAGRSARNKTRGECLLVLTPSEEEYMISALKEQLNIDIRCVQIDPKK 467
            |..|:..|.|:.:..||||.||:||....|.....|...:|:..:..:.:..:..|:...:.|:.
Zfish   560 VKCVINYDAPQYIRTYIHRVGRTARAGKAGLAFTFLLKVQEKRFLKMVSDAGSPGIQKQHVHPEA 624

  Fly   468 LFSPRVKIEAFLAQ 481
            |.|...:.|..||:
Zfish   625 LKSMESRYEQVLAE 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 118/457 (26%)
DEADc 74..277 CDD:238167 69/246 (28%)
HELICc 311..437 CDD:238034 36/125 (29%)
DUF4217 474..530 CDD:290667 3/8 (38%)
ddx51NP_001003864.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..145
P-loop_NTPase 195..439 CDD:304359 70/256 (27%)
DEXDc 204..451 CDD:214692 72/274 (26%)
Q motif 212..220 3/9 (33%)
DEAD box 362..365 2/2 (100%)
Helicase_C 475..586 CDD:278689 33/111 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.