DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and CG7483

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster


Alignment Length:421 Identity:114/421 - (27%)
Similarity:201/421 - (47%) Gaps:39/421 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LAATEAEIQDLKTKYAEI--DATAIKKFAQFPLSKKTQKALAESKFVHPTQVQRDSIGPALQGKD 111
            :|...|:.:||.....|.  |...|..|....|.::..:.:....|..|:.:|:.||.|.::|:|
  Fly     1 MARKNAQAEDLSNVEFETSEDVEVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRD 65

  Fly   112 VLGAAITGSGKTLAFLIPVLEHLFMNKWSRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFSAG 176
            |:..|.:|:|||..|.|.:|:.|  :...|...|  :.:|||||||.||.:.:..:|...:....
  Fly    66 VIAQAQSGTGKTATFSISILQSL--DTTLRETQV--LCLSPTRELAVQIQKVILALGDMMNVQCH 126

  Fly   177 LIIGGKNLKFERTRMDQ-CNILICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMGFQKTLN 240
            :.|||.||..:..::|. .:|:..||||:.. |.:..:..|..::||||||||..|:.||::.:.
  Fly   127 VCIGGTNLGEDIRKLDYGQHIVSGTPGRVFD-MIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIY 190

  Fly   241 SIIENFPPVRQTLLFSATQTNTVQDLARLNLKDPVYVGYGGATPREEPSASTKKTPNTAVLAVPE 305
            .:....||..|.:|.|||..:.:.::....:.||:.:    ...|:|.:.              |
  Fly   191 DVYRYLPPATQVVLISATLPHEILEMTSKFMTDPIRI----LVKRDELTL--------------E 237

  Fly   306 LLQQSYVVLNLED-KITMLWSFIKNHLKQKIIVFVASCKQAKYLYEIFCKLRPGS-PLLALYGTL 368
            .::|.:|.:..|: |...|..........:.::|..:.::..:|.|   |:|..: .:.:::|.:
  Fly   238 GIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTE---KMREANFTVSSMHGDM 299

  Fly   369 HQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDVSQYIHRAGRSAR------ 427
            .|..|..|.::|......|:.:|||.:||:|...|:.|:..|.|.:...||||.|||.|      
  Fly   300 PQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGV 364

  Fly   428 --NKTRGECLLVLTPSEEEYMISALKEQLNI 456
              |..:.:.:.:|...|:.|.....:..:|:
  Fly   365 AINFVKSDDIRILRDIEQYYSTQIDEMPMNV 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 114/421 (27%)
DEADc 74..277 CDD:238167 65/203 (32%)
HELICc 311..437 CDD:238034 34/135 (25%)
DUF4217 474..530 CDD:290667
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 113/418 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.