DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and Rm62

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster


Alignment Length:472 Identity:134/472 - (28%)
Similarity:215/472 - (45%) Gaps:58/472 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GSRFKPGSGTFKGAGGGRKSGDNSQKRPRQEINKSRLA---------------ATEAEIQDLKTK 62
            |:||..|.|.....|||   |..||..|.:.::.|.||               .:..|:|    :
  Fly   206 GNRFGGGGGFGDRRGGG---GGGSQDLPMRPVDFSNLAPFKKNFYQEHPNVANRSPYEVQ----R 263

  Fly    63 YAEID--------ATAIKKFAQFPLSKKTQKALAESKFVHPTQVQRDSIGPALQGKDVLGAAITG 119
            |.|..        ...|:.|::..|.....|.:....:..||.:|......|:.|.:.:|.|.||
  Fly   264 YREEQEITVRGQVPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTG 328

  Fly   120 SGKTLAFLIPVLEHL-FMNKWSRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFSAGLIIGGKN 183
            |||||.:::|.:.|: ......|.||..|::::||||||.||.:...:.|.........:.||..
  Fly   329 SGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAP 393

  Fly   184 LKFERTRMDQ-CNILICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFP 247
            ...:...:.: |.|:|.|||||:..:..... |......||||||||.|||||:..:..|:....
  Fly   394 KGGQMRDLQRGCEIVIATPGRLIDFLSAGST-NLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIR 457

  Fly   248 PVRQTLLFSATQTNTVQDLARLNLKDPVYVGYGGATPREEPSASTKKTPNTAVLAVPELLQQSYV 312
            |.||||::|||....|:.||...|.:.:.:..|          |.:.:.|..:..|.::..:   
  Fly   458 PDRQTLMWSATWPKEVKQLAEDFLGNYIQINIG----------SLELSANHNIRQVVDVCDE--- 509

  Fly   313 VLNLEDKITMLWSFIKNHLKQ--KIIVFVASCKQAKYLYEIFCK--LRPGSPLLALYGTLHQDRR 373
             .:.|:|:..|.|.|.:..:.  |||:||.:.::...|......  :|.|    |::|...|..|
  Fly   510 -FSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCG----AIHGDKSQSER 569

  Fly   374 IAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDVSQYIHRAGRSARNKTRGECLLVL 438
            ..:..:|......::.:||||:||||...:.:|:..|.|::...||||.||:.|:.|:|......
  Fly   570 DFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFF 634

  Fly   439 TPS---EEEYMISALKE 452
            |.:   :.:.::..|:|
  Fly   635 TKNNAKQAKALVDVLRE 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 134/472 (28%)
DEADc 74..277 CDD:238167 69/204 (34%)
HELICc 311..437 CDD:238034 38/129 (29%)
DUF4217 474..530 CDD:290667
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 115/391 (29%)
DEADc 283..488 CDD:238167 69/205 (34%)
HELICc 499..633 CDD:238034 39/141 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.