DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and abs

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_524220.1 Gene:abs / 40530 FlyBaseID:FBgn0015331 Length:619 Species:Drosophila melanogaster


Alignment Length:437 Identity:134/437 - (30%)
Similarity:214/437 - (48%) Gaps:51/437 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KRPR--QEINKSRLAATEAEIQDLKTKYAEIDATAIKKFAQFPLSKKTQKALAESKFVHPTQVQR 100
            |.||  :|:::....|...|::.|..  .|..:..|:.|.:....|.....||.....:||.:|.
  Fly   143 KPPRYIREMSEEEREAVRHELRILVE--GETPSPPIRSFREMKFPKGILNGLAAKGIKNPTPIQV 205

  Fly   101 DSIGPALQGKDVLGAAITGSGKTLAFLIPV----LEHLFMNKWSRTDGVGAIIISPTRELAYQIF 161
            ..:...|.|:|::|.|.|||||||.|::||    ||..:...:.|.:|...:||.|:||||.|..
  Fly   206 QGLPTVLAGRDLIGIAFTGSGKTLVFVLPVIMFALEQEYSLPFERNEGPYGLIICPSRELAKQTH 270

  Fly   162 ETLKKVGKH------HDFSAGLIIGGKNLKFERTRMDQ-CNILICTPGRLLQHMDENPLFNTSTM 219
            |.::...||      .:..:.|.:||..:......:.: .:|::.|||||:..:|:..|    |:
  Fly   271 EIIQHYSKHLQACGMPEIRSCLAMGGLPVSEALDVISRGVHIVVATPGRLMDMLDKKIL----TL 331

  Fly   220 EM---LVLDEADRCLDMGFQKTLNSIIENFPPVRQTLLFSATQTNTVQDLARLNLKDPVYVGYGG 281
            :|   |.:|||||.:||||::.:.:|...|...|||||||||....:|:.||..|..||.:..|.
  Fly   332 DMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKKIQNFARSALVKPVTINVGR 396

  Fly   282 ATPREEPSASTKKTPNTAVLAVPELLQQSYVVLNLEDKITMLWSFIKNHLKQK----IIVFVASC 342
            |     .:||...|...      |.::|...|:.|.|.:            ||    :::|....
  Fly   397 A-----GAASMNVTQQV------EYVKQEAKVVYLLDCL------------QKTAPPVLIFAEKK 438

  Fly   343 KQAKYLYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVV 407
            :....::|..  |..|...:|::|...|:.|....:.:......|:.:|||||:|||||.|..|:
  Fly   439 QDVDCIHEYL--LLKGVEAVAIHGGKDQEERSRAVDAYRVGKKDVLVATDVASKGLDFPNVQHVI 501

  Fly   408 QLDCPEDVSQYIHRAGRSARNKTRGECLLVLTPSEEEYMISALKEQL 454
            ..|.|:|:..|:||.||:.|:.|:|....::..:.|:.::..||..|
  Fly   502 NYDMPDDIENYVHRIGRTGRSNTKGLATTLINKTTEQSVLLDLKHLL 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 134/437 (31%)
DEADc 74..277 CDD:238167 77/216 (36%)
HELICc 311..437 CDD:238034 37/129 (29%)
DUF4217 474..530 CDD:290667
absNP_524220.1 DEADc 179..393 CDD:238167 77/217 (35%)
DEXDc 192..397 CDD:214692 76/208 (37%)
Helicase_C 414..523 CDD:278689 35/122 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.