DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and CG6418

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_648413.1 Gene:CG6418 / 39218 FlyBaseID:FBgn0036104 Length:791 Species:Drosophila melanogaster


Alignment Length:422 Identity:128/422 - (30%)
Similarity:207/422 - (49%) Gaps:49/422 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 IKKFAQFPLSKKTQKALAESKFVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHLF 135
            :..|..|...::..||:.::::..||.:|..::..||.|:|::|.|.||||||.||:.|:|.|:.
  Fly   268 VTSFGHFGFDEQLIKAVRKAEYTQPTPIQAQAVPTALSGRDIIGIAKTGSGKTAAFIWPMLMHVM 332

  Fly   136 MNKWSRT-DGVGAIIISPTRELAYQIFETLKKVGKHHDFSAGLIIGGKNLKFERTR-MDQ-CNIL 197
            ..|..:. ||...:|::|||||:.||:...||.||.::.:.....||.: |:|::: ::| ..|:
  Fly   333 DQKQLKPGDGPIGLILAPTRELSLQIYNEAKKFGKVYNLNVVCCYGGGS-KWEQSKALEQGAEII 396

  Fly   198 ICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFPPVRQTLLFSATQTNT 262
            :.||||::. |.:....|...:..||||||||...|||:..:.||..:..|.||.|:||||....
  Fly   397 VATPGRMID-MVKMKATNLRRVTFLVLDEADRMFHMGFEPQVRSICNHVRPDRQCLMFSATFKKR 460

  Fly   263 VQDLARLNLKDPVYVGYGGATPREEPSASTKKTPNTAVLAVPELLQQSYVVLNLEDKITMLWSFI 327
            ::.|||..|.|||.:..|......:                 ::.|..||..|...|    |:::
  Fly   461 IERLARDVLSDPVRIVQGDLNEANQ-----------------DITQSVYVFPNPLQK----WNWL 504

  Fly   328 KNHL-----KQKIIVFVASCKQAK------YLYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFL 381
            ..||     :..:::||.....|:      .:.|..|        |.|:|.:.|..|..:...|.
  Fly   505 LCHLVKFLSEGSVLIFVTKKVDAETVSNNLLIKEYNC--------LLLHGDMDQADRNKVITQFK 561

  Fly   382 RKSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDVSQYIHRAGRSARNKTRGECLLVLTPSEEEYM 446
            ||...::.:||||:||||.|.:..||..|...|:..:.||.||:.|...:|....::|..::|:.
  Fly   562 RKECDILVATDVAARGLDIPHIRNVVNYDTARDIETHTHRIGRTGRAGEKGNAYTLVTDKDKEFA 626

  Fly   447 ISALKEQLNIDIRCVQIDPKKLFSPRVKIEAF 478
            ...::.....|    |:.|..|....:|...|
  Fly   627 GHLVRNLEGAD----QLVPDDLMELAMKSSWF 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 126/413 (31%)
DEADc 74..277 CDD:238167 79/205 (39%)
HELICc 311..437 CDD:238034 39/136 (29%)
DUF4217 474..530 CDD:290667 2/5 (40%)
CG6418NP_648413.1 DEADc 271..475 CDD:238167 79/205 (39%)
DEXDc 284..489 CDD:214692 76/223 (34%)
Helicase_C 504..609 CDD:278689 33/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.