DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and mus301

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_648178.1 Gene:mus301 / 38905 FlyBaseID:FBgn0002899 Length:1051 Species:Drosophila melanogaster


Alignment Length:675 Identity:141/675 - (20%)
Similarity:235/675 - (34%) Gaps:169/675 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQRQKPKGPGKPGSRFKPGSGTF--KGAGGGRKSGDNSQKRPRQEI-NKSRLAATEAEIQ---DL 59
            |..:|||.|.|..:..|..|.:|  |....|...|  :|....:|: |:|.|.....|.|   |.
  Fly   166 MTFKKPKTPEKLLAPLKDDSMSFISKSVIEGLVQG--TQYVTCEELKNQSLLDPVNWETQAFADF 228

  Fly    60 KTKYAEIDATAIKKFAQ----FPLSKKTQKALAESKFVHPTQVQRDSI--GPAL-QGKDVLGAAI 117
            :....:||     ||..    :.|..|.:|.:.|.|.::.....:|..  .||: |.|:::.|..
  Fly   229 EKNNQDID-----KFPSKGEFYGLPDKVKKMILEHKGINSLYEWQDECLNLPAIRQRKNLIYALP 288

  Fly   118 TGSGKTLAFLIPVLEHLFMNKWSRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFSAGLIIGGK 182
            |..||||...|.:|..|...:.:      .:.|.|...:..:....:.......||.......||
  Fly   289 TSGGKTLVAEILMLRELLCRERN------VLFILPYVSIVQEKVSAMSPFAIDLDFIVEEYTAGK 347

  Fly   183 NLKFERTRMDQCNILICT--PGRLLQHMD-----ENPLFNTSTMEMLVLDEADRCLDMGFQKTLN 240
            .....:.|..:.::.|.:  .|.:|  ||     :.|    ..:.::|:||.....:.|...||.
  Fly   348 GKCPPQPRRKRRSLFIASIEKGAVL--MDSLIDVQRP----HEIGLVVVDELHLIGEKGRGATLE 406

  Fly   241 SIIENFPPVR---QTLLFSATQTNTVQDLARLN------------LKDPVYVG------------ 278
            :.:.....:.   |.:..|||..|..:..:.||            ||:.:..|            
  Fly   407 AFLTKVMFLNANIQIVGMSATIGNLSEISSFLNADVYTRGFRPVELKEYIKCGPDLLEINSAGQT 471

  Fly   279 --------------YGGATPREEPS-------------------ASTKKTPNTAVLAVPELLQQS 310
                          |..|..|.:|.                   .|.|...|.|:|.        
  Fly   472 LEEIFVPSRSVEYNYSEAVKRADPDHLAGLISECAPEHCCLVFCPSRKNCENVALLL-------- 528

  Fly   311 YVVLNLEDKITMLWSFIKNHLKQKIIVFVASCKQAKYLYEIFCKLRPGSPLLALYGT------LH 369
                   .:|.....|.::...:|:.:..|..|....|..:..|..|       ||.      |.
  Fly   529 -------SRIVPKHKFFEHRRSEKLDLMDALDKMCGILSPVLAKTLP-------YGIAYHHSGLT 579

  Fly   370 QDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLD---------CPEDVSQYIHRAGRS 425
            .|.|..|...:......|:..|...:.|::.||...:::..         |  ...|.:.||||:
  Fly   580 TDERKYIETAYRFGVVTVICCTSTLAAGVNLPAKRVIIRAPYVGQEFLTLC--KYKQMVGRAGRA 642

  Fly   426 ARNKTRGECLLVLTPSEEEYMISALKEQLNIDIRCVQIDPKKLFSPRVKIEAFLAQFPELRATAQ 490
            ...:. ||.:|: ..|::..::..:                 ||||   ::..|:...:..|...
  Fly   643 GLGEA-GESILI-AQSKDNLLVGQM-----------------LFSP---MDKALSSLDQNEAVGL 685

  Fly   491 RAFLSYIKSVFLMRNKRLFN--VFSLDLDAFAQSLGLAVTPRVPFLEKFLWRQKQLQQQKEQGDN 553
            ::.:..:..:.|...:|..|  |.|..|...|:||.:||...|..:.:.:::.|.||..:.|   
  Fly   686 QSLILSVVGLNLAECRRDLNRLVNSTLLSVQAKSLEVAVNEIVLRILREMFKNKVLQLAEPQ--- 747

  Fly   554 AKS-INP---LLSKLTKQQSFGGGD 574
            ||| ||.   :.|:...|.:...||
  Fly   748 AKSKINSSDIITSQDVSQANRPAGD 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 111/563 (20%)
DEADc 74..277 CDD:238167 48/231 (21%)
HELICc 311..437 CDD:238034 27/140 (19%)
DUF4217 474..530 CDD:290667 13/57 (23%)
mus301NP_648178.1 BRR2 247..998 CDD:224125 117/587 (20%)
DEXHc_POLQ-like 247..449 CDD:350784 45/213 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.