DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and Dbp45A

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_476927.1 Gene:Dbp45A / 35917 FlyBaseID:FBgn0010220 Length:521 Species:Drosophila melanogaster


Alignment Length:553 Identity:137/553 - (24%)
Similarity:243/553 - (43%) Gaps:74/553 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 TQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHLFMNKWSRTDGVGAIIISPTRELAYQI 160
            |.:|:..|...|.|:|.:|||.||||||.||.:|:||.|.....|..    |::::||.||||||
  Fly    31 TPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILERLSEEPVSHF----ALVLTPTHELAYQI 91

  Fly   161 FETLKKVGKHHDFSAGLIIGGKNLKFERTR-MDQCNILICTPGRLLQHMDENPLFNTSTMEMLVL 224
            .|.....|:.......::.||.:...|..: |.:.:|::..||||..|:.....|:...::.||:
  Fly    92 SEQFLVAGQAMGVRVCVVSGGTDQMVESQKLMQRPHIVVAMPGRLADHLTGCDTFSFDNLKYLVV 156

  Fly   225 DEADRCLDMGFQKTLNSIIENFPPVRQTLLFSATQTNTVQDLARLNLKDPVYVGYGGATPREEPS 289
            |||||.|:..|.::|:.|....|..||.|.||||..:.:::.:...:....:             
  Fly   157 DEADRMLNGDFDESLSIIERCLPKTRQNLFFSATMKDFIKESSIFPIASDCF------------- 208

  Fly   290 ASTKKTPNTAVLAVPELLQQSYVVLNLEDKITMLWSFIKNHLKQ----KIIVFVASCKQAKYLYE 350
                :....:.:|..|.|.|.|::....|:..:|...::.:.::    .:::|..:.|..:.|..
  Fly   209 ----EWSQDSDVATVETLDQRYLLCADYDRDMVLIEALRKYREENENANVMIFTNTKKYCQLLSM 269

  Fly   351 IFCKLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDV 415
            ....:...:  :.|:|.:.|..|:|....|.......:.:||||:||||.|:|..|:....|...
  Fly   270 TLKNMEIDN--VCLHGFMRQKERVAALSRFKSNQIRTLIATDVAARGLDIPSVELVMNHMLPRTP 332

  Fly   416 SQYIHRAGRSARNKTRGECLLVLTPSEEEYMISALKEQLNIDIRCVQIDPKKLFSPRVKIEAFLA 480
            .:||||.||:||...:|..:.:.....:..:::|::|::|..                     |.
  Fly   333 KEYIHRVGRTARAGRKGMSISIFRFPRDLELLAAIEEEINTK---------------------LT 376

  Fly   481 QFPELRATAQRAFLSYIKSVFLMRNKRLFNVFSLDLDAFAQSL---GLAVTPRVPFLEKFLWRQK 542
            :.|..:...:|.|:    .|.:.|.:....:.:.|.|..||:.   ...:..:.|...:.|:|:|
  Fly   377 EHPIDQRMVERIFM----QVNVTRRESEMQLDNNDFDERAQNYRRKTWIMEGKDPDQMEALYRKK 437

  Fly   543 QLQQQKEQGDNAKSINPLLSKLTKQQSF--GGGDEDEENSDDEDFIKVKRKDHDVEGEPVKLDEE 605
            |..:.:|           :.:..|.|..  ...:|.:....||.|..|.....:.:|:......:
  Fly   438 QKDKLRE-----------IRRKRKLQHAEPAASEEGKALLQDERFKSVDSARFEKKGKGRSRATQ 491

  Fly   606 DDTENEAEAPLVVPKREKLVTKASLAKKALKKN 638
            :||..:   ||....:||.|  |...:..:||:
  Fly   492 EDTPTK---PLKRLNKEKPV--AQKGRADVKKD 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 103/379 (27%)
DEADc 74..277 CDD:238167 63/181 (35%)
HELICc 311..437 CDD:238034 33/129 (26%)
DUF4217 474..530 CDD:290667 10/58 (17%)
Dbp45ANP_476927.1 SrmB 8..490 CDD:223587 127/517 (25%)
DEADc 9..197 CDD:238167 63/169 (37%)
Helicase_C 239..346 CDD:278689 29/108 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.