DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and CG9253

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_610090.1 Gene:CG9253 / 35379 FlyBaseID:FBgn0032919 Length:507 Species:Drosophila melanogaster


Alignment Length:464 Identity:149/464 - (32%)
Similarity:235/464 - (50%) Gaps:55/464 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SQKRPRQEINKSRLAATEAEIQDLKTKYAEIDATAIKK--FAQFPLSKKTQKALAESKFVHPTQV 98
            |::....|.|..:...:||.:.....|.:|.||...:|  :....|::...:|..|.|:..|:::
  Fly    23 SEEEQEDEDNNHKEGDSEAALSGEDDKGSEDDAAEEQKLTWKDLGLNEALCQACDELKWKAPSKI 87

  Fly    99 QRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHLFMNKWSRTDGVGAIIISPTRELAYQIFET 163
            ||::|..|||||||:|.|.||||||.||.:|:|..|..|    .....|::::||||||:||.|.
  Fly    88 QREAIPVALQGKDVIGLAETGSGKTGAFALPILHALLEN----PQRYFALVLTPTRELAFQIGEQ 148

  Fly   164 LKKVGKHHDFSAGLIIGGKNLKFERTRM-DQCNILICTPGRLLQHMDENPLFNTSTMEMLVLDEA 227
            .:.:|........:::||.::..:..:: .:.:|:|.|||||:.|::....||...::.||:|||
  Fly   149 FEALGSGIGIKCCVVVGGMDMVAQGLQLAKKPHIIIATPGRLVDHLENMKGFNLKAIKYLVMDEA 213

  Fly   228 DRCLDMGFQKTLNSIIENFPPVRQTLLFSATQTNTVQDLARLNLKDPVYVGYGGATPREEPSAST 292
            ||.|:|.|:..|:.|::..|..|:|.|||||.|..|:.|.|.:|||||.|           ..|.
  Fly   214 DRILNMDFEVELDKILKVLPRERRTFLFSATMTKKVKKLQRASLKDPVKV-----------EVSN 267

  Fly   293 KKTPNTAVLAVPELLQQSYVVLNLEDKITMLWSFIKNHLKQKIIVFVASC----KQAKYLYEIFC 353
            |       ....|.|||||:.:.::.|...|...:........::|.::|    |.|..|..:  
  Fly   268 K-------YQTVEQLQQSYLFIPVKYKDVYLVHILNELAGNSFMIFCSTCNNTVKTALMLRAL-- 323

  Fly   354 KLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDVSQY 418
                |...:.|:|.:.|::|:|....|..|:..::.||||||||||.|.|:.||..|.|.....|
  Fly   324 ----GLAAIPLHGQMSQNKRLAALNKFKAKNRSILISTDVASRGLDIPHVDVVVNFDIPTHSKDY 384

  Fly   419 IHRAGRSARNKTRGECLLVLTPSE--------------------EEYMISALKEQLNIDIRCVQI 463
            |||.||:||....|:.:.:::..:                    ||..:.||:|::....|..::
  Fly   385 IHRVGRTARAGRSGKAITLVSQYDIELYQRIEHLLGKQLTLYKCEEDEVMALQERVAEAQRTAKL 449

  Fly   464 DPKKLFSPR 472
            :.|.|...|
  Fly   450 ELKDLEDTR 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 148/461 (32%)
DEADc 74..277 CDD:238167 81/203 (40%)
HELICc 311..437 CDD:238034 41/129 (32%)
DUF4217 474..530 CDD:290667
CG9253NP_610090.1 SrmB 34..498 CDD:223587 146/453 (32%)
DEADc 63..264 CDD:238167 82/215 (38%)
HELICc 274..403 CDD:238034 45/134 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.