DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and me31B

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_523533.2 Gene:me31B / 34364 FlyBaseID:FBgn0004419 Length:459 Species:Drosophila melanogaster


Alignment Length:417 Identity:125/417 - (29%)
Similarity:205/417 - (49%) Gaps:40/417 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QDLKTKYAEIDATAIKKFAQFPLSKKTQKALAESKFVHPTQVQRDSIGPALQGKDVLGAAITGSG 121
            :|.:.|..::..|...:|.:|.|.::....:.|..:..|:.:|..:|..||.|||||..|..|:|
  Fly    43 KDNRFKTTDVTDTRGNEFEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTG 107

  Fly   122 KTLAFLIPVLEHLFMNKWSRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFSAGLIIGGKNLKF 186
            ||.|:.|||||.:...|    |.:.|:::.||||||.|..:...::.||.|....:..||..||.
  Fly   108 KTGAYCIPVLEQIDPTK----DYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILKD 168

  Fly   187 ERTRMDQ-CNILICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFPPVR 250
            :..|:.| ..::|.||||:|..||:. :.:.|...:|||||||:.|.:.||..|:.:|...|...
  Fly   169 DILRIYQKVQLIIATPGRILDLMDKK-VADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDP 232

  Fly   251 QTLLFSATQTNTVQDLARLNLKDPVYVGYGGATPREEPSASTKKTPNTAVLAVPEL----LQQSY 311
            |.||||||...||::....:|::|..:.                       .:.||    :.|.|
  Fly   233 QILLFSATFPLTVKNFMEKHLREPYEIN-----------------------LMEELTLKGVTQYY 274

  Fly   312 VVLNLEDKITMLWS-FIKNHLKQKIIVFVASCKQAKYLYEIFCKLRPGSPLLALYGTLHQDRRIA 375
            ..:....|:..|.: |.|..:.|.|| |..|.::.:.|.:...:|  |.....::..:.|..|..
  Fly   275 AFVQERQKVHCLNTLFSKLQINQSII-FCNSTQRVELLAKKITEL--GYCCYYIHAKMAQAHRNR 336

  Fly   376 IYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDVSQYIHRAGRSARNKTRGECLLVLTP 440
            ::.||.:.....:..:|:.:||:|..|||.|:..|.|.....|:||.|||.|....|..:.::| 
  Fly   337 VFHDFRQGLCRNLVCSDLFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLIT- 400

  Fly   441 SEEEYMISALKEQLNIDIRCVQ--IDP 465
            .|:.:.:..::::|..:|:.:.  |||
  Fly   401 YEDRFDLHRIEKELGTEIKPIPKVIDP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 125/417 (30%)
DEADc 74..277 CDD:238167 77/203 (38%)
HELICc 311..437 CDD:238034 35/126 (28%)
DUF4217 474..530 CDD:290667
me31BNP_523533.2 PTZ00424 60..422 CDD:185609 119/393 (30%)
DEADc 60..260 CDD:238167 77/204 (38%)
HELICc 270..398 CDD:238034 36/130 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.