DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and Hel25E

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_723089.1 Gene:Hel25E / 33781 FlyBaseID:FBgn0014189 Length:424 Species:Drosophila melanogaster


Alignment Length:412 Identity:106/412 - (25%)
Similarity:204/412 - (49%) Gaps:34/412 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EAEIQDLKTKYAEIDATAIKKFAQFPLSKKTQKALAESKFVHPTQVQRDSIGPALQGKDVLGAAI 117
            ||..:|:|..|..|.::.   |..|.|..:..:|:.:..|.||::||.:.|..|:.|.|:|..|.
  Fly    25 EAPKKDVKGTYVSIHSSG---FRDFLLKPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAK 86

  Fly   118 TGSGKTLAFLIPVLEHLFMNKWSRTDGVGAIIISPTRELAYQIFETLKKVGKH-HDFSAGLIIGG 181
            :|.|||..|::..|:.|   :.|..:....:::..|||||:||.:..::..|: ......:..||
  Fly    87 SGMGKTAVFVLATLQQL---EPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGG 148

  Fly   182 KNL-KFERT-RMDQCNILICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLD-MGFQKTLNSII 243
            ..: |.|.| :....:|::.||||:|. :..|...|...::..||||.|:.|: :..::.:..|.
  Fly   149 MAIQKDEETLKSGTPHIVVGTPGRILA-LIRNKKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIF 212

  Fly   244 ENFPPVRQTLLFSATQTNTVQDLARLNLKDP--VYVGYGGATPREEPSASTKKTPNTAVLAVPEL 306
            .:.|..:|.::||||.:..::.:.:..::||  |||                  .:.|.|.: ..
  Fly   213 RSTPHGKQVMMFSATLSKDIRPVCKKFMQDPMEVYV------------------DDEAKLTL-HG 258

  Fly   307 LQQSYVVLNLEDKITMLWSFIKNHLKQKIIVFVASCKQAKYLYEIFCKLRPGSPLLALYGTLHQD 371
            |||.||.|...:|...|:..:......::::||.|.::...|.::..:  ...|.:.::..:.|:
  Fly   259 LQQHYVNLKENEKNKKLFELLDVLEFNQVVIFVKSVQRCVALSQLLTE--QNFPAIGIHRGMTQE 321

  Fly   372 RRIAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDVSQYIHRAGRSARNKTRGECLL 436
            .|:..|:.|......::.:|::..||:|...||.|...|.|||...|:||..|:.|..|:|..:.
  Fly   322 ERLNRYQQFKDFQKRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAIT 386

  Fly   437 VLTPSEEEYMISALKEQLNIDI 458
            .::...:..:::.::::.:::|
  Fly   387 FVSDENDAKILNEVQDRFDVNI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 106/412 (26%)
DEADc 74..277 CDD:238167 60/208 (29%)
HELICc 311..437 CDD:238034 32/125 (26%)
DUF4217 474..530 CDD:290667
Hel25ENP_723089.1 DEADc_DDX39 40..248 CDD:350708 60/214 (28%)
SF2_C_DEAD 259..388 CDD:350174 35/130 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451341
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.