DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and Dbp21E2

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_608544.1 Gene:Dbp21E2 / 33254 FlyBaseID:FBgn0086130 Length:536 Species:Drosophila melanogaster


Alignment Length:537 Identity:133/537 - (24%)
Similarity:206/537 - (38%) Gaps:135/537 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RKSGDNSQKRPRQEINKSRLAATEAEIQDLKTKYAEIDATAIKKFAQFPLSKK------------ 82
            :..|...:..|.....:|:.        || |:|.:.||    ||....|:.|            
  Fly    35 KSKGKKQKGEPLISCRRSQF--------DL-TQYEQTDA----KFGSLSLASKGWLHNKSKGDFF 86

  Fly    83 -----------TQKALAESKF-------VHP---------------TQVQRDSIGPALQGKD-VL 113
                       .|:.....:|       :||               |.:|:..: |.:.|.: .|
  Fly    87 ILNASVRGEELQQEMQTVDEFLESTGMQIHPQLLENLRVELGIKLLTGIQKQGM-PVVHGNEHCL 150

  Fly   114 GAAITGSGKTLAFLIPVLEHLFMNK---WSRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFSA 175
            .||.||.|||:.:|:|:::.|...:   ..:.:....:|::|.||||.||....:|:.:..:...
  Fly   151 IAAETGCGKTITYLLPIVDKLLQKEVVTERKLNTPRVLILTPGRELATQIAGVTEKLTQGTNLKV 215

  Fly   176 GLIIGGK------NLKFERTRMDQCNILICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCLDMG 234
            ..::||.      |.:||     :.:||:.|.| .|..:....::....:..|||||||..||..
  Fly   216 QSLLGGNTKQLMMNPQFE-----EVDILVATLG-ALSKLVTTGIYRMEQVRHLVLDEADTLLDDT 274

  Fly   235 FQKTLNSIIENFP--------PVRQTLLFSATQ-TNTVQDLARLNLKDPVYVGYGGATPREEPSA 290
            |...|:..:..||        ...|.:|.|||. |||.:.|.::...|         |.||..| 
  Fly   275 FTDKLSYFLRRFPFHLVQKEDAGTQMILASATMPTNTREILHKVIDVD---------TIREVVS- 329

  Fly   291 STKKTPNTAVLAVPEL------LQQSYVVLNLEDKITMLWSFIKNHL--KQKIIVFVASCKQAKY 347
                         |.|      :.|.::.|:..|:...|.|.:|:.|  ::.:|||......:.:
  Fly   330 -------------PHLHRLMSHVTQKFLRLSKADRPATLLSLVKHDLAKRRPLIVFSNKSTTSDF 381

  Fly   348 LYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLDCP 412
            : .||.. ..|...|.|.|.:....|:..:|.|......|:.:|||.|||||......||..|.|
  Fly   382 V-SIFLN-NSGVNCLNLNGDMLMKIRLGRFEQFQNGHCDVLSTTDVGSRGLDTTRARHVVNFDFP 444

  Fly   413 EDVSQYIHRAGRSARNKTRGECLLV-LTPSEEEYMI----------SALKEQLNIDIRCVQIDPK 466
            ..||.||||.||..|.....:.|:. |..|..|..:          ..|...:|.:||       
  Fly   445 LHVSDYIHRCGRIGRVGNMDKALVTNLISSRREIDVVQRIEHAARTGGLLPDVNANIR------- 502

  Fly   467 KLFSPRVKIEAFLAQFP 483
            .:.:.|:..|...|..|
  Fly   503 NIINKRIVAEMKAAGMP 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 129/523 (25%)
DEADc 74..277 CDD:238167 64/266 (24%)
HELICc 311..437 CDD:238034 41/127 (32%)
DUF4217 474..530 CDD:290667 3/10 (30%)
Dbp21E2NP_608544.1 P-loop_NTPase 113..314 CDD:304359 57/207 (28%)
DEXDc 126..330 CDD:214692 61/233 (26%)
HELICc 343..462 CDD:238034 40/120 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.