DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and mahe

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster


Alignment Length:508 Identity:143/508 - (28%)
Similarity:230/508 - (45%) Gaps:83/508 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QKPKGPGKPGSRFKPGSGTFKGAGGGRKSGDNS-------QKRPRQEINKSR------------- 48
            |:.|.|.......||.:|.  |..||.:|.:.:       .|..|.||.:.:             
  Fly   129 QRGKNPTYAQRYQKPNNGA--GVAGGYQSNNYNAAALGMLSKEERAEIQREKAKNPGRNLVKPKW 191

  Fly    49 -----------------LAATEAEIQDLKTKYAEIDATA--------IKKFAQFPLSKKTQKALA 88
                             ||.:|.::.:::   .|::.|.        :..|.:..|.....:.:.
  Fly   192 ENLEPFLKDFYNIHPNTLAKSEQQVAEIR---RELEITVSGNELPHPVVSFEESSLPAHVIEEMK 253

  Fly    89 ESKFVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHL-FMNKWSRTDGVGAIIISP 152
            ...|..||.:|......||.|:|::|.|.||||||||:::|.:.|: ......|.:|..|::::|
  Fly   254 RQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQPPIIRGEGPIALVLAP 318

  Fly   153 TRELAYQIFETLKKVGKHH----DFSAGLIIGGKNLKFERTRMDQ-CNILICTPGRLLQHMDENP 212
            |||||.||...::..|  |    :.....|.||.:...:...:|: ..::|.|||||:..: ||.
  Fly   319 TRELAQQIQSVVRDYG--HLCKPEIRHTCIFGGSSKVPQARDLDRGVEVIIATPGRLIDFL-ENR 380

  Fly   213 LFNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFPPVRQTLLFSATQTNTVQDLARLNLKDPVYV 277
            ..|......||||||||.|||||:..:..|||...|.||.:::|||....||.||...|.|.:.:
  Fly   381 NTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQI 445

  Fly   278 GYGGATPREEPSASTKKTPNTAVLAVPEL---LQQSYVVLNLEDKITMLWSFIKN--HLKQKIIV 337
            ..|          |...:.|..:..:.|:   :::...::.|.::|    |.|||  :...||||
  Fly   446 NIG----------SMNLSANHNIRQIVEICTEIEKPQRLVCLLNEI----SPIKNSGNNGNKIIV 496

  Fly   338 FVASCKQAKYLYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPA 402
            ||.:..:.:.:.:|.  ...|....:::|...|:.|.::.:||......::.:|||||||||...
  Fly   497 FVETKIKVEDILQII--RAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVED 559

  Fly   403 VNWVVQLDCPEDVSQYIHRAGRSARNKTRGECLLVLTP---SEEEYMISALKE 452
            :.:|:..|.|.....|:||.||:.|.:..|......||   .:...:||.|:|
  Fly   560 LQYVINYDYPNSSENYVHRIGRTGRCQQLGTAYTFFTPDNAKQARELISVLEE 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 143/508 (28%)
DEADc 74..277 CDD:238167 76/208 (37%)
HELICc 311..437 CDD:238034 38/127 (30%)
DUF4217 474..530 CDD:290667
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 140/501 (28%)
DEADc 239..446 CDD:238167 76/209 (36%)
HELICc 457..594 CDD:238034 39/142 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.