DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5800 and CG14443

DIOPT Version :9

Sequence 1:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_572330.2 Gene:CG14443 / 31595 FlyBaseID:FBgn0029880 Length:736 Species:Drosophila melanogaster


Alignment Length:468 Identity:90/468 - (19%)
Similarity:194/468 - (41%) Gaps:58/468 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RKSGDNSQKRPRQEI--------NKSRLAATEAEIQDLKTKYAEIDATAIKKFAQFPLSKKTQKA 86
            |.|..|:.|:|..|:        .:..:..|...:::|        ...:..|.:...:....:.
  Fly   288 RPSNYNTWKQPMDEVYNNAANYRKRHNITLTSWNMRNL--------PEPVLSFERSGFNATILQQ 344

  Fly    87 LAESKFVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHLFMNK--WSRTDGVGAII 149
            |.:..:..||.:|..:...|.:||:::..:..|:||||.:|:|.:..:...:  .....|...:|
  Fly   345 LEDQGYDGPTPIQAQTWSIAKEGKNIVMISGKGTGKTLGYLLPGIMKMHNQRGLMQHKKGPIVLI 409

  Fly   150 ISPTRELAYQIFETLKKVGKHHDFSAGLIIGGKNLKFERTRMDQCNILICTPGRLLQHMD-ENPL 213
            :...||.|..:...:.......:.....::|....:...    :|::|:.:.|||||.:| :..:
  Fly   410 LVDCREAAVMVQREVLYYTNPLELRTHCLLGNSQWQGHA----ECDLLVASAGRLLQMIDNKKHV 470

  Fly   214 FNTSTMEMLVLDEADRCLDMGFQKTLNSIIENFPPVRQTLLFSATQTNTVQDLARLNLKDPVYVG 278
            ........||||..||.:|:|.:..:..::....|..|.::.|.:.::.::.:|...|.....:.
  Fly   471 VELERCTYLVLDNIDRMIDVGLEGNICRLLCRLRPHAQLIVSSTSWSSNLKRMANKFLGQYTAIR 535

  Fly   279 YGGATPREEPSASTKKTPNTAVLAVPELLQQSYVVLNLEDKITMLWS-----FIKNHLKQKIIVF 338
            .|             :..|..|..  :.::|...|:|...|:..|..     :..:.:..|::::
  Fly   536 VG-------------EINNIGVRL--QNIRQRVEVVNGLSKVERLMKELTAIYDTSDIPGKVVIY 585

  Fly   339 VASCKQAKYLYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPAV 403
            |   |:.|.:.|:...:|...|...::|.........|..||...::.::.:|.:.|..||.|.:
  Fly   586 V---KRQKVVEELVDLIRNCVPCEGIHGGRTAQENQGIIHDFGTGAYNIIVATQMTSNCLDVPGI 647

  Fly   404 NWVVQLDCPEDVSQYIHRAGRSARNKTRGECLLVLTPSEEEY-MISALKEQLNIDIRC------- 460
            .:|:..|.|:::.:|:.|..|:........|.::...:...| :::.:.:.|.|   |       
  Fly   648 RYVINYDFPDNIDKYVQRMSRTGCLSYNRNCEVISFFTMANYKLVTEVVDFLKI---CKQEIGPH 709

  Fly   461 -VQIDPKKLFSPR 472
             :|:..:|:|.||
  Fly   710 LLQLAEEKMFGPR 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 88/465 (19%)
DEADc 74..277 CDD:238167 42/205 (20%)
HELICc 311..437 CDD:238034 27/130 (21%)
DUF4217 474..530 CDD:290667
CG14443NP_572330.2 P-loop_NTPase 332..535 CDD:304359 42/206 (20%)
DEXDc 345..544 CDD:214692 43/215 (20%)
Helicase_C 560..670 CDD:278689 24/112 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.