Sequence 1: | NP_573229.1 | Gene: | CG8289 / 32741 | FlyBaseID: | FBgn0030854 | Length: | 336 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001355054.1 | Gene: | CDYL / 9425 | HGNCID: | 1811 | Length: | 598 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 45/207 - (21%) |
---|---|---|---|
Similarity: | 72/207 - (34%) | Gaps: | 69/207 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 TRRSVRGETEDSNELPSTSKASAHASSPIKKRKLSRASTSSVKNGKKVAEKDSESDVDAGTEDEK 190
Fly 191 SAQPQKVAAKSKSSPNAKKAKGRGRRNAGTKKADDSIDPEKQWEVEKILDHVATKEGDM-FKIRW 254
Fly 255 KKYGPKDDSWEPSKNLA-CDALIEKFMRK--QATQENVDVKELRESPKKTERLVDECYPRTNLHN 316
Fly 317 RIERSSKRSSAK 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8289 | NP_573229.1 | CHROMO | 233..284 | CDD:214605 | 20/54 (37%) |
CDYL | NP_001355054.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..76 | 21/121 (17%) | |
Interaction with EZH2. /evidence=ECO:0000269|PubMed:22009739 | 61..309 | 29/134 (22%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 112..149 | 9/49 (18%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..226 | ||||
Acetyl-CoA-binding domain. /evidence=ECO:0000255 | 362..594 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1911 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |