DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8289 and CBX4

DIOPT Version :9

Sequence 1:	NP_573229.1	Gene:	CG8289 / 32741	FlyBaseID:	FBgn0030854	Length:	336	Species:	Drosophila melanogaster
Sequence 2:	NP_003646.2	Gene:	CBX4 / 8535	HGNCID:	1554	Length:	560	Species:	Homo sapiens

Alignment Length:	99	Identity:	23/99 - (23%)
Similarity:	46/99 - (46%)	Gaps:	0/99 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   230 EKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLACDALIEKFMRKQATQENVDVKEL 294
            |..:.||.|......|....:.::|:.:.||.::|||.:|:....|:..|..::..::.:..::.
Human     8 EHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKR 72

  Fly   295 RESPKKTERLVDECYPRTNLHNRIERSSKRSSAK 328
            ...||.....|.....|:|:...::.||..:.||
Human    73 GPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAK 106

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8289	NP_573229.1	CHROMO	233..284	CDD:214605	13/50 (26%)
CBX4	NP_003646.2	Interaction with BMI1	1..539		23/99 (23%)
		Involved in interaction with H3C15 and H3C1. /evidence=ECO:0000269\|PubMed:18927235	1..75		14/66 (21%)
		CHROMO	10..62	CDD:214605	13/51 (25%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	92..152		4/15 (27%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	217..243
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	281..404
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	509..528
		Involved in interaction with H3C15 and RNF2. /evidence=ECO:0000269\|PubMed:18927235	531..556
		CBX7_C	<538..559	CDD:319236
		Interaction with RNF2	540..560
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.920