powered by:
Protein Alignment CG8289 and cbx8b
DIOPT Version :9
Sequence 1: | NP_573229.1 |
Gene: | CG8289 / 32741 |
FlyBaseID: | FBgn0030854 |
Length: | 336 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001019586.1 |
Gene: | cbx8b / 799361 |
ZFINID: | ZDB-GENE-050522-325 |
Length: | 361 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 19/71 - (26%) |
Similarity: | 34/71 - (47%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 230 EKQWEVEKILDHVATKEGDM-FKIRWKKYGPKDDSWEPSKNLACDALIEKFMRKQATQENVDVKE 293
|:.:..|.|:.. ..:.|.| :.::||.:.||..:|||.:|:....|...|..::..:|....|
Zfish 8 ERVFAAESIIKR-RIRRGHMEYLVKWKGWSPKYSTWEPEENILDPRLFVAFEEREREREIFGPK- 70
Fly 294 LRESPK 299
:..||
Zfish 71 -KRGPK 75
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628171at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.