DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and cbx5

DIOPT Version :10

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001073653.1 Gene:cbx5 / 563396 ZFINID:ZDB-GENE-030131-5553 Length:204 Species:Danio rerio


Alignment Length:68 Identity:22/68 - (32%)
Similarity:40/68 - (58%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 GRRNAGTKKADDSIDPEKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLACDALIEK 278
            |:::...:..:.:...|:::.|||:||....|....:.::||.:..|.::|||.|||.|..||.:
Zfish     2 GKKSQNREDDEAASSDEEEYVVEKVLDRRVVKGRVEYFLKWKGFTEKHNTWEPEKNLDCPELISE 66

  Fly   279 FMR 281
            ||:
Zfish    67 FMK 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CD_CSD 233..281 CDD:349274 19/47 (40%)
cbx5NP_001073653.1 CD_HP1alpha_Cbx5 20..69 CDD:349298 19/48 (40%)
CSD_HP1alpha_Cbx5 132..189 CDD:349302
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.