DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and cbx7a

DIOPT Version :10

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001017853.2 Gene:cbx7a / 550551 ZFINID:ZDB-GENE-050417-400 Length:393 Species:Danio rerio


Alignment Length:144 Identity:29/144 - (20%)
Similarity:50/144 - (34%) Gaps:43/144 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 EKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLACDALIEKFMRK------------ 282
            |:.:.||.|......|....:.::|:.:.||..:|||..|:....|:..|..|            
Zfish     8 EQVFAVESITKKRIRKGNVEYLLKWQGWSPKYSTWEPEDNILDPRLVLAFEEKAEKDRALAYKKK 72

  Fly   283 -----QATQENVDVKELRESPKKTERLVDECYPRTNL----------------------HNRIER 320
                 |....|:...:||.:.|    :.|:..||..|                      :.|::.
Zfish    73 GLRPRQVILRNIYPMDLRSAHK----VPDKPSPRIRLSLTRSMSTEVDQNGRRYRDSVVYRRLKN 133

  Fly   321 SSKRSSAKNRIFYG 334
            ..|....::|:|.|
Zfish   134 RYKNRQCRSRLFEG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CD_CSD 233..281 CDD:349274 13/47 (28%)
cbx7aNP_001017853.2 CD_Cbx7 7..62 CDD:349293 15/53 (28%)
CBX7_C <358..382 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.