DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and Cbx7

DIOPT Version :10

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_006521207.1 Gene:Cbx7 / 52609 MGIID:1196439 Length:251 Species:Mus musculus


Alignment Length:99 Identity:24/99 - (24%)
Similarity:40/99 - (40%) Gaps:12/99 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 EKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLACDALIEKFMRKQATQENVDVKEL 294
            |:.:.||.|......|....:.::||.:.||..:|||.:::....|:..:..|:........:  
Mouse     8 EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYR-- 70

  Fly   295 RESPKKTERLVDECYPRTNLHNRIERSSKRSSAK 328
            :..||          ||..|..|:.....|||.|
Mouse    71 KRGPK----------PRRLLLQRLYSMDLRSSHK 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CD_CSD 233..281 CDD:349274 12/47 (26%)
Cbx7XP_006521207.1 CD_Cbx7 7..62 CDD:349293 14/53 (26%)
CBX7_C 209..240 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.