DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and rhi

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster


Alignment Length:304 Identity:70/304 - (23%)
Similarity:110/304 - (36%) Gaps:79/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ASKKVAESKRRNGVANESENEEIDQQKSNGTGRSSRKTPNKRKAKLTVASDSEDSDCQTSTSNVD 68
            :|||..:..:.....|.:...:::|:|    |::.:||..|.|...........|..|.||.:.:
  Fly   108 SSKKTQQHSKSVQAKNTAGMSKMNQKK----GKNIKKTAGKIKDIENYPKTQMPSTSQVSTDSTE 168

  Fly    69 V----PAARNKRKVGKARNATTSPRKNGKKIVIEDSDDDANHSDVDPSADSSPRKPNIKR--QTR 127
            |    |:|       ...|...|||       |:....|.|.  ::|:.|......::|.  ::|
  Fly   169 VFDGNPSA-------TTTNMIKSPR-------IQSLFSDLNL--IEPTKDKDVGDTSLKTPPKSR 217

  Fly   128 RSVRGETEDSNELPSTSKASAHASSPIKKRKLSRASTSSVKNGKKVAEKDSESDVD--AGTEDEK 190
            |.:  |.....:.|.:||   |. ||:..||.|:...||..:...:.|..|...:.  :.|..||
  Fly   218 RLI--EFPQREDAPLSSK---HV-SPMLIRKESQPLQSSCTDDSDLGESSSSMSLPTVSSTSSEK 276

  Fly   191 SAQPQKVAAK--------SKSSPNAKKAKGRGRRNAGTKKAD----DSIDPEKQ----------- 232
            |.:..|...|        |:||.....|...|....|....|    ||:|.|.:           
  Fly   277 SIKVTKSEPKTLGQIKFSSRSSDGGHAASSLGAPKEGDIGLDLSGSDSMDSEVESMRRCPRRKRK 341

  Fly   233 -----W---------------EVEKILDHVATKEGDMFK-IRWK 255
                 |               :::||| |......|:|. :.||
  Fly   342 KTYPDWKFPEMTKPFGVNRGLDLDKIL-HCYQMNDDLFMFVTWK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 9/39 (23%)
rhiNP_536794.1 CHROMO 22..72 CDD:237991
ChSh 357..411 CDD:294039 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.