DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and cbx5

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_988907.2 Gene:cbx5 / 394502 XenbaseID:XB-GENE-972727 Length:200 Species:Xenopus tropicalis


Alignment Length:131 Identity:39/131 - (29%)
Similarity:62/131 - (47%) Gaps:5/131 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 SSPNAKKAKGRGRRNAGTKKADD--SIDPEKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWE 265
            :.|...:....|::|   |:|.|  |...|:::.|||:||....|....|.::||.:..:.::||
 Frog     8 TGPRPNREGTMGKKN---KRASDASSSSEEEEYVVEKVLDRRVVKGQVEFLLKWKGFSEEHNTWE 69

  Fly   266 PSKNLACDALIEKFMRKQATQENVDVKELRESPKKTERLVDECYPRTNLHNRIERSSKRSSAKNR 330
            |.:||.|..||.:||:|....:..|.|...||.|:.....|....:....|.|.|..:|.....:
 Frog    70 PDRNLDCPELISEFMKKYKKVKETDPKAKTESTKRKAGSDDIKAKKRRESNDIARGFERGLEPEK 134

  Fly   331 I 331
            |
 Frog   135 I 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 20/50 (40%)
cbx5NP_988907.2 CD_HP1alpha_Cbx5 37..85 CDD:349298 18/47 (38%)
CSD_HP1alpha_Cbx5 125..182 CDD:349302 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.