DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and Cbx1

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_006247295.1 Gene:Cbx1 / 360609 RGDID:1310714 Length:193 Species:Rattus norvegicus


Alignment Length:126 Identity:35/126 - (27%)
Similarity:57/126 - (45%) Gaps:18/126 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 KKADDSI-DPEKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLACDALIEKFMRKQA 284
            ||.::.: :.|:::.|||:||....|....:.::||.:..:|::|||.:||.|..||.:|::.|.
  Rat     8 KKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQK 72

  Fly   285 TQENVDV--------------KELRESPKKTERLVDECYPRTNLHNRIERSSKRSSAKNRI 331
            |....|.              |.....|||.:   :|..|...|.:...|...|.....||
  Rat    73 TAHETDKSDGGKRKADSDSEDKGEESKPKKKK---EEALPIWFLQSEKPRGFARGLEPERI 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 18/50 (36%)
Cbx1XP_006247295.1 Chromo 27..70 CDD:278797 15/42 (36%)
Chromo_shadow 126..177 CDD:279701 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.