DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and Su(var)205

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster


Alignment Length:107 Identity:30/107 - (28%)
Similarity:50/107 - (46%) Gaps:8/107 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 KADDSIDPEKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLACDALIEKF--MRKQA 284
            |..|:.:.|:::.||||:|....|....:.::||.|...:::|||..||.|..||:::  .||..
  Fly    13 KVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDE 77

  Fly   285 TQENVDVKELRESPKKTERLVDECYPRTNLHNRIERSSKRSS 326
            .:.....|:...|..|.:.........|:      .:|||.|
  Fly    78 EKSAASKKDRPSSSAKAKETQGRASSSTS------TASKRKS 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 19/52 (37%)
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 17/47 (36%)
ChSh 141..202 CDD:197638
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.