DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and Cbx8

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_038954.1 Gene:Cbx8 / 30951 MGIID:1353589 Length:362 Species:Mus musculus


Alignment Length:300 Identity:73/300 - (24%)
Similarity:103/300 - (34%) Gaps:84/300 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GRS-------SRKTPNKRKAKLTVASDSEDSDCQTSTSNVDVPAARNKRKVGKARNATTSPRKNG 92
            |||       ||.....|...|.....|      |||...|.|..|::.            |..|
Mouse   108 GRSPQDLASTSRAREGLRNTGLPPPGSS------TSTCRADPPRDRDRE------------RDRG 154

  Fly    93 KKIVIEDSDDDANHSDVDPSADSSPRKPNIKRQTRRSVRGETEDSNELPSTSKASAHASSPIKKR 157
            ...|     ||...|..|.|....| ||          |.|..|.::.| ..:.||.....:|.|
Mouse   155 TSRV-----DDKPSSPGDSSKKRGP-KP----------RKEPLDPSQRP-LGEPSAGLGEYLKGR 202

  Fly   158 KLSRASTSSVK--NGKKVAE--KDSESD-VDAGTEDEKSAQ-PQKVAAKS------KSSPNAKKA 210
            ||...|:.:.|  .|..|.:  :..:|| |..|.....||: ..|:|..:      |......:|
Mouse   203 KLDETSSGTGKFPAGHSVIQLARRQDSDLVQYGVTSPSSAEASSKLAVDTFPARVIKHRAAFLEA 267

  Fly   211 KGRG---------RRNAGTKKADDSI--DPEKQWEVEKILDH--VATKEGDMFKIRWKKYGPKDD 262
            ||:|         |.::||..:..|:  |...|.....::..  ||...||          |:::
Mouse   268 KGQGALDPGGARVRHSSGTPASVGSLYRDMGAQGGRPSLIARIPVARILGD----------PEEE 322

  Fly   263 SWEPS----KNLACDALIEKFMRKQATQENVD---VKELR 295
            ||.||    :.:....:...|:.....:.|.|   .||.|
Mouse   323 SWSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 10/56 (18%)
Cbx8NP_038954.1 CHROMO 10..62 CDD:214605
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..197 31/123 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.