DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and Cbx5

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001100267.1 Gene:Cbx5 / 300266 RGDID:1306619 Length:191 Species:Rattus norvegicus


Alignment Length:131 Identity:37/131 - (28%)
Similarity:64/131 - (48%) Gaps:17/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 KKAKGRGRRNAGTKKADDSIDPEKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLAC 272
            ||.|    |.|.:..::|    |:::.|||:||....|....:.::||.:..:.::|||.|||.|
  Rat     3 KKTK----RTADSSSSED----EEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDC 59

  Fly   273 DALIEKFMRKQATQENVDVKELRESPKKTERLVDECYPRTNLHNRIE--RSSKRSSAKNRIFYGE 335
            ..||.:||:|....:..:..:.||..:..:|       :::..|..:  :|.|:....|.|..|.
  Rat    60 PELISEFMKKYKKMKEGENNKPREKSEGNKR-------KSSFSNSADDIKSKKKREQSNDIARGF 117

  Fly   336 E 336
            |
  Rat   118 E 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 20/50 (40%)
Cbx5NP_001100267.1 CD_HP1alpha_Cbx5 19..68 CDD:349298 18/48 (38%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.