DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and Cbx3

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001008314.2 Gene:Cbx3 / 297093 RGDID:1549705 Length:183 Species:Rattus norvegicus


Alignment Length:107 Identity:33/107 - (30%)
Similarity:51/107 - (47%) Gaps:12/107 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 GRRNAGTKKADDSIDPEKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLACDALIEK 278
            |::..|..|..:..:|| ::.|||:||.........:.::||.:...|::|||.:||.|..|||.
  Rat    12 GKKQNGKSKKVEEAEPE-EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEA 75

  Fly   279 FMRKQATQENVD---VKELRES------PKKTERLVDECYPR 311
            |:..|...:..|   .|.|.:|      .||.....|:  ||
  Rat    76 FLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADK--PR 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 18/50 (36%)
Cbx3NP_001008314.2 CD_HP1gamma_Cbx3 29..78 CDD:349299 18/48 (38%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303 33/107 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.