DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and clr4

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_595186.1 Gene:clr4 / 2540825 PomBaseID:SPBC428.08c Length:490 Species:Schizosaccharomyces pombe


Alignment Length:109 Identity:26/109 - (23%)
Similarity:57/109 - (52%) Gaps:11/109 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 EKQWEVEKILDHVATKEG--DMFKIRWKKYGPKDDSWEPSKNLA-CDALIEKFMRKQATQENVDV 291
            ::::|||:|:|....:.|  .:::|||..|..:.|:|||.:||: |.|::.::.|::        
pombe     5 QEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRRK-------- 61

  Fly   292 KELRESPKKTERLVDECYPRTNLHNRIERSSKRSSAKNRIFYGE 335
            :.|:.|...::.......|..|...:.:..:.:|..:::.|..|
pombe    62 RRLKGSNSDSDSPHHASNPHPNSRQKHQHQTSKSVPRSQRFSRE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 19/53 (36%)
clr4NP_595186.1 SET 1..489 CDD:225491 26/109 (24%)
CHROMO 7..62 CDD:214605 19/62 (31%)
PreSET 209..312 CDD:128744
SET 329..451 CDD:214614
PostSET 474..489 CDD:214703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I3639
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.