DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and CBX5

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001120793.1 Gene:CBX5 / 23468 HGNCID:1555 Length:191 Species:Homo sapiens


Alignment Length:131 Identity:38/131 - (29%)
Similarity:64/131 - (48%) Gaps:17/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 KKAKGRGRRNAGTKKADDSIDPEKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLAC 272
            ||.|    |.|.:..::|    |:::.|||:||....|....:.::||.:..:.::|||.|||.|
Human     3 KKTK----RTADSSSSED----EEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDC 59

  Fly   273 DALIEKFMRKQATQENVDVKELRESPKKTERLVDECYPRTNLHNRIE--RSSKRSSAKNRIFYGE 335
            ..||.:||:|....:..:..:.||..:..:|       ::|..|..:  :|.|:....|.|..|.
Human    60 PELISEFMKKYKKMKEGENNKPREKSESNKR-------KSNFSNSADDIKSKKKREQSNDIARGF 117

  Fly   336 E 336
            |
Human   118 E 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 20/50 (40%)
CBX5NP_001120793.1 CD_HP1alpha_Cbx5 19..68 CDD:349298 18/48 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..117 9/53 (17%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.