DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and hpl-1

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_510199.1 Gene:hpl-1 / 181450 WormBaseID:WBGene00001995 Length:184 Species:Caenorhabditis elegans


Alignment Length:119 Identity:32/119 - (26%)
Similarity:61/119 - (51%) Gaps:12/119 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 SKSSPNAKKAKGRGRRNAGTKKADDSIDPEKQ------WEVEKILDHVATKEGDMFKIRWKKYGP 259
            |:.:| .:..:|...|....::|.|:  |..|      :.|||:|:...|:.|..:.|:|:.:..
 Worm     2 SRQNP-VRSTRGNSLRAREAQQAQDA--PLFQESSSNVFVVEKVLNKRLTRGGSEYYIKWQGFPE 63

  Fly   260 KDDSWEPSKNLACDALIEKFMRKQATQENVDVKELRESPKKTERLVDECYPRTN 313
            .:.||||.:||.||.:|:::.::.|.:   ..::.|.||:.:.....|..|.|:
 Worm    64 SECSWEPIENLQCDRMIQEYEKEAAKR---TTRKRRYSPQPSTSSSAELQPSTS 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 17/50 (34%)
hpl-1NP_510199.1 CD_HP1_like 36..85 CDD:349316 17/48 (35%)
ChSh 114..174 CDD:197638 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.