DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and cec-6

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_500828.1 Gene:cec-6 / 177338 WormBaseID:WBGene00020463 Length:891 Species:Caenorhabditis elegans


Alignment Length:375 Identity:71/375 - (18%)
Similarity:129/375 - (34%) Gaps:85/375 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KASKKVAESKRRNGVANESENEEIDQQKSNGTGRSSRKTPNKRK-----AKLTVASDSEDSDCQ- 61
            |...::.|.:.|.....|.:|.: :|.|:......:.....|:|     :::...||.|.:... 
 Worm   119 KTDDEIEEKRARKKAKLEEQNRK-EQAKNPHASAETEPAVKKKKIEGVGSRIPKISDREGAGTSG 182

  Fly    62 TSTSNVDVPA-----------ARNKRKVGKARN-----ATTSPRKNGKKIVIEDSDDDANHSDVD 110
            .|:|||..|.           .:...::|:|..     ||.|.......|:    |...:.||:.
 Worm   183 QSSSNVSTPGITPLDNKTPRMQKKSNEIGQASTPECAIATLSIGTPQPSII----DSTYDQSDIA 243

  Fly   111 PSADSSPRKPNIKRQTRRSVRGETEDSNELPSTSKASAHASSPIKKRKLSRASTSSVKNGKKVAE 175
            ..:.|...:|..||:    :.|:        ..|..|.|.............|||          
 Worm   244 NGSTSPQPQPVFKRK----MNGQ--------DVSDYSVHQGGTFSDGSAIEGSTS---------- 286

  Fly   176 KDSESDVDAGTEDEKSAQPQKVAAKSKSSPNAKKAKGRGRRNAGTKKADDSIDP-------EKQW 233
            ::|| |:|...|.:|:.|....:|:.:.....|..| :......:.:......|       .:..
 Worm   287 RESE-DMDCTQETKKALQKAIESAREECEEIEKTIK-KYPLQVTSSRVVTGFSPALTLRKFRRCQ 349

  Fly   234 EVEKILDHVATK-EGDMFKIRWKKYGPKDDSWEPSKNLACDA---LI-------EKFMRKQATQE 287
            .:|.:.||.... |.::|          ..::|.|..|..||   :|       |.|:.||....
 Worm   350 SLEMLSDHFNNNAEMEIF----------GKNFENSVRLDADAKPVVIKIYPQEQELFLTKQRKMP 404

  Fly   288 NVDVKEL------RESPKKTERLVDECYPRTNLHNRIERSSKRSSAKNRI 331
            ::::::|      :|:....:..:....|..|....:|..|...|..:.|
 Worm   405 SLEMEQLVYENLVKENANNIKIAMHNIRPDKNFAQLLECLSHAYSKDDNI 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 14/61 (23%)
cec-6NP_500828.1 Mating_C 123..>278 CDD:372279 33/171 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.