DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and hpl-2

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001022654.1 Gene:hpl-2 / 176506 WormBaseID:WBGene00001996 Length:303 Species:Caenorhabditis elegans


Alignment Length:114 Identity:33/114 - (28%)
Similarity:57/114 - (50%) Gaps:10/114 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 TKKADDSIDPEKQWEVEKILDHVATKEG-DMFKIRWKKYGPKDDSWEPSKNLACDALIEKFMRKQ 283
            ||:|......:..:.|||:||....|.| |.|.|:|:.:...|.||||.:||.|..::::|.|:.
 Worm     6 TKRAKIEDPKDNVFMVEKVLDKRTGKAGRDEFLIQWQGFPESDSSWEPRENLQCVEMLDEFEREF 70

  Fly   284 ATQENVDVKELRESPKKTERLVDECYPRTNLHNRIERSSKRSSAKNRIF 332
            :.:|....|...:.|:.:|   |:..|..      ::..|:.:.:|..|
 Worm    71 SKREKPIRKRHSQKPEPSE---DQADPEE------DKDEKKETNQNDKF 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 21/51 (41%)
hpl-2NP_001022654.1 CD_HP1_like 18..68 CDD:349316 20/49 (41%)
CD_CSD 109..>153 CDD:391946 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.