DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and cec-8

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_497198.1 Gene:cec-8 / 175202 WormBaseID:WBGene00021913 Length:679 Species:Caenorhabditis elegans


Alignment Length:367 Identity:96/367 - (26%)
Similarity:161/367 - (43%) Gaps:95/367 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKASKKVAESKRRNGVANESENEEIDQQKSNGTGRSSRKTPNKRKAKLTVASDSEDS--DCQTST 64
            :|.|||.::.:::   |::||.|.::.:|::   :|.:|||.|...|    .:||:|  |.:...
 Worm   323 SKKSKKESDEEQQ---ASDSEEEVVEVKKNS---KSPKKTPKKTAVK----EESEESSGDEEEEV 377

  Fly    65 SNVDVPAARNKRKVGKA------------RNATTSPRKNGKKIVI-EDSDDDANHSDVDPSADSS 116
            ......:..||||..::            :..|.||||:.||... |:|:::::.::.:...|.|
 Worm   378 VKKKKSSKINKRKAKESSSDEEEEVEESPKKKTKSPRKSSKKSAAKEESEEESSDNEEEEEVDYS 442

  Fly   117 PRKPNIKRQTRRSVRGETEDSNELPSTSKASAH--ASSPIKK----RKLSRASTSSVKNGKKVAE 175
            |:| .:|...:.|.:...:..:|.||.::....  ..|||||    ||.||.|.:.|        
 Worm   443 PKK-KVKSPKKSSKKPAAKVESEEPSDNEEEEEEVEESPIKKDKTPRKYSRKSAAKV-------- 498

  Fly   176 KDSESDVDAGTEDEKSAQPQKVAAKSKSSPNAKKAKGRGRRNAGTKKADDSIDPEKQWEVEKILD 240
               ||...:|.|:|:..:         .||   |.||:..|.:..|.|.......::.:||:   
 Worm   499 ---ESTESSGNEEEEEVE---------ESP---KKKGKTPRKSSKKSAAVEESDNEEEDVEE--- 545

  Fly   241 HVATKEGDMFKIRWKKYGPKDDSWE------------PSKNLACDALIEKFMRKQATQ------- 286
              :.|:....:...||...|::|.|            |.||   |..:.|..||.|.:       
 Worm   546 --SPKKRTSPRKSSKKRAAKEESEESSDNEVEEVEDSPKKN---DKTLRKSPRKPAAKVESEESF 605

  Fly   287 ENVDVKELRESPKKTERLVDECYPRTNLHNRIERSSKRSSAK 328
            .|.:.:|:.|||||..:.     ||        :|||:|:||
 Worm   606 GNEEEEEVEESPKKKGKT-----PR--------KSSKKSAAK 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 15/62 (24%)
cec-8NP_497198.1 CD_CEC-4_like 114..167 CDD:349317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.