DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and W05F2.8

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001249353.1 Gene:W05F2.8 / 13179739 WormBaseID:WBGene00195045 Length:132 Species:Caenorhabditis elegans


Alignment Length:125 Identity:21/125 - (16%)
Similarity:52/125 - (41%) Gaps:17/125 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKASKKVAESKRRNGVANESENEEIDQQKSNGTGRSSRKTPNKRKAKLTVASDSEDSDCQTSTS 65
            |.:..|:::|.|::..:..:..::|..:........::.:...:|:.:..::.|           
 Worm     1 MERRHKRISEGKKKRLIGEDDADDEWPEMPPGHRILTTEEHEMQRRKESKISQD----------- 54

  Fly    66 NVDVPAARNKRKVGKARNATTSPRKNGKKIVIEDSDDDANH-----SDVDPSADSSPRKP 120
             |::..|.:.:|:.:...|......:..:..:|||.|...|     |..|.:::|.|..|
 Worm    55 -VEMTEAFDLQKMREFFPANGDLLSSFPQDFLEDSGDGEVHEAAILSVFDDNSNSPPPCP 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605
W05F2.8NP_001249353.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.