DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and Cdyl

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_034011.1 Gene:Cdyl / 12593 MGIID:1339956 Length:593 Species:Mus musculus


Alignment Length:152 Identity:33/152 - (21%)
Similarity:65/152 - (42%) Gaps:30/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 SESDVDAGTEDEKSAQPQKVAAKSKSSPNAKKAKGRGRRNAGTKKADDSIDPEKQWEVEKILDHV 242
            :|...|..|..:.:..|..|:...::||..:.|                     :.:||.|:|..
Mouse    22 AEQPTDDNTCQQNNVVPATVSEPDQASPAIQDA---------------------ETQVESIVDKR 65

  Fly   243 ATKEGDM-FKIRWKKYGPKDDSWEPSKNLA-CDALIEKFMRK--QATQENVDVKELRESPKKTER 303
            ..|:|.. :.:|||.|..:||:|||.::|. |:..|..|.|:  :..:|....:..|.||....:
Mouse    66 KNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHNERQKEGSLARASRASPSNARK 130

  Fly   304 LVDECYPRTNLHNRIERSSKRS 325
            .:..     :.|:.:.:::.::
Mouse   131 QISR-----STHSTLSKTNSKA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 20/54 (37%)
CdylNP_034011.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 2/7 (29%)
CHROMO 55..109 CDD:214605 20/53 (38%)
Interaction with EZH2. /evidence=ECO:0000250|UniProtKB:Q9Y232 56..304 25/97 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..158 5/43 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..223
crotonase-like 339..535 CDD:119339
Acetyl-CoA-binding domain. /evidence=ECO:0000255 357..589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.